Comparing 15410 FitnessBrowser__Keio:15410 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 88% coverage: 21:256/268 of query aligns to 13:244/375 of 2d62A
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 92% coverage: 5:251/268 of query aligns to 1:241/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 92% coverage: 5:251/268 of query aligns to 2:242/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
30% identity, 92% coverage: 5:251/268 of query aligns to 2:242/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
30% identity, 92% coverage: 5:251/268 of query aligns to 2:242/344 of 6cvlD
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 85% coverage: 26:252/268 of query aligns to 13:237/240 of 4ymuJ
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 81% coverage: 34:251/268 of query aligns to 46:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 81% coverage: 34:251/268 of query aligns to 46:263/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
32% identity, 82% coverage: 29:248/268 of query aligns to 41:260/260 of 7ahdC
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 94% coverage: 5:255/268 of query aligns to 3:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 94% coverage: 5:255/268 of query aligns to 3:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 94% coverage: 5:255/268 of query aligns to 3:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 94% coverage: 5:255/268 of query aligns to 3:242/242 of 2oljA
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
28% identity, 95% coverage: 5:259/268 of query aligns to 3:269/330 of P0AAH4
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 86% coverage: 28:257/268 of query aligns to 31:250/378 of P69874
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
29% identity, 91% coverage: 8:252/268 of query aligns to 6:242/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
29% identity, 91% coverage: 8:252/268 of query aligns to 6:242/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
29% identity, 91% coverage: 8:252/268 of query aligns to 6:242/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
29% identity, 91% coverage: 8:252/268 of query aligns to 6:242/353 of Q97UY8
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
31% identity, 90% coverage: 1:242/268 of query aligns to 4:220/353 of 1vciA
>15410 FitnessBrowser__Keio:15410
MIETLLEVRNLSKTFRYRTGWFRRQTVEAVKPLSFTLREGQTLAIIGENGSGKSTLAKML
AGMIEPTSGELLIDDHPLHFGDYSFRSQRIRMIFQDPSTSLNPRQRISQILDFPLRLNTD
LEPEQRRKQIIETMRMVGLLPDHVSYYPHMLAPGQKQRLGLARALILRPKVIIADEALAS
LDMSMRSQLINLMLELQEKQGISYIYVTQHIGMMKHISDQVLVMHQGEVVERGSTADVLA
SPLHELTKRLIAGHFGEALTADAWRKDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory