Comparing 15429 FitnessBrowser__Keio:15429 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D7BAR0 Glucosylglycerate phosphorylase; GGa phosphorylase; GGaP; EC 2.4.1.352 from Allomeiothermus silvanus (strain ATCC 700542 / DSM 9946 / NBRC 106475 / NCIMB 13440 / VI-R2) (Thermus silvanus) (see paper)
46% identity, 100% coverage: 1:558/559 of query aligns to 8:553/555 of D7BAR0
P10249 Sucrose phosphorylase; Glucosyltransferase-A; GTF-A; Sucrose glucosyltransferase; EC 2.4.1.7 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
32% identity, 83% coverage: 49:512/559 of query aligns to 7:455/481 of P10249
Sites not aligning to the query:
7znpA Structure of amedsp
29% identity, 78% coverage: 49:486/559 of query aligns to 6:442/502 of 7znpA
D9TT09 Sucrose 6(F)-phosphate phosphorylase; Sucrose 6'-phosphate phosphorylase; SPP; EC 2.4.1.329 from Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIMB 9385 / NCA 3814 / NCTC 13789 / WDCM 00135 / 2032) (Clostridium thermosaccharolyticum) (see 2 papers)
29% identity, 84% coverage: 46:513/559 of query aligns to 4:461/488 of D9TT09
A0ZZH6 Sucrose phosphorylase; SP; SPase; EC 2.4.1.7 from Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) (see paper)
29% identity, 80% coverage: 49:495/559 of query aligns to 5:445/504 of A0ZZH6
2gduA E232q mutant of sucrose phosphorylase from bifidobacterium adolescentis in complex with sucrose (see paper)
29% identity, 80% coverage: 49:495/559 of query aligns to 5:445/504 of 2gduA
5c8bB Structural insights into the redesign of a sucrose phosphorylase by induced loop repositioning (see paper)
29% identity, 80% coverage: 49:495/559 of query aligns to 5:445/504 of 5c8bB
5m9xB Structure of sucrose phosphorylase from bifidobacterium adolescentis bound to glycosylated resveratrol (see paper)
29% identity, 80% coverage: 49:495/559 of query aligns to 5:445/504 of 5m9xB
3ueqA Crystal structure of amylosucrase from neisseria polysaccharea in complex with turanose (see paper)
27% identity, 99% coverage: 4:559/559 of query aligns to 46:630/632 of 3ueqA
7xdqA Crystal structure of a glucosylglycerol phosphorylase mutant from marinobacter adhaerens
29% identity, 86% coverage: 49:530/559 of query aligns to 5:456/470 of 7xdqA
Q9ZEU2 Amylosucrase; EC 2.4.1.4 from Neisseria polysaccharea (see 2 papers)
27% identity, 99% coverage: 4:559/559 of query aligns to 50:634/636 of Q9ZEU2
1jgiA Crystal structure of the active site mutant glu328gln of amylosucrase from neisseria polysaccharea in complex with the natural substrate sucrose (see paper)
26% identity, 99% coverage: 4:559/559 of query aligns to 42:626/628 of 1jgiA
1s46A Covalent intermediate of the e328q amylosucrase mutant (see paper)
26% identity, 99% coverage: 4:559/559 of query aligns to 42:626/628 of 1s46A
E4PMA5 Glucosylglycerol phosphorylase; GGoP; 2-O-alpha-D-glucopyranosylglycerol:phosphate alpha-D-glucosyltransferase; 2-O-alpha-D-glucosylglycerol phosphorylase (retaining); EC 2.4.1.359 from Marinobacter adhaerens (strain DSM 23420 / HP15) (see paper)
28% identity, 86% coverage: 49:530/559 of query aligns to 7:466/480 of E4PMA5
A0R6E0 Trehalose synthase/amylase TreS; Maltose alpha-D-glucosyltransferase; MTase; EC 3.2.1.1; EC 5.4.99.16 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
26% identity, 77% coverage: 86:515/559 of query aligns to 80:523/593 of A0R6E0
5jy7B Complex of mycobacterium smegmatis trehalose synthase with maltokinase (see paper)
26% identity, 77% coverage: 86:515/559 of query aligns to 64:507/571 of 5jy7B
3zoaB The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
26% identity, 77% coverage: 86:515/559 of query aligns to 64:507/571 of 3zoaB
Sites not aligning to the query:
3zoaA The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
29% identity, 64% coverage: 73:428/559 of query aligns to 40:382/548 of 3zoaA
Sites not aligning to the query:
3zo9A The structure of trehalose synthase (tres) of mycobacterium smegmatis (see paper)
29% identity, 64% coverage: 73:428/559 of query aligns to 41:383/549 of 3zo9A
Sites not aligning to the query:
4lxfA Crystal structure of m. Tuberculosis tres (see paper)
26% identity, 82% coverage: 73:529/559 of query aligns to 66:527/570 of 4lxfA
>15429 FitnessBrowser__Keio:15429
MKQKITDYLDEIYGGTFTATHLQKLVTRLESAKRLITQRRKKHWDESDVVLITYADQFHS
NDLKPLPTFNQFYHQWLQSIFSHVHLLPFYPWSSDDGFSVIDYHQVASEAGEWQDIQQLG
ECSHLMFDFVCNHMSAKSEWFKNYLQQHPGFEDFFIAVDPQTDLSAVTRPRALPLLTPFQ
MRDHSTRHLWTTFSDDQIDLNYRSPEVLLAMVDVLLCYLAKGAEYVRLDAVGFMWKEPGT
SCIHLEKTHLIIKLLRSIIDNVAPGTVIITETNVPHKDNIAYFGAGDDEAHMVYQFSLPP
LVLHAVQKQNVEALCAWAQNLTLPSSNTTWFNFLASHDGIGLNPLRGLLPESEILELVEA
LQQEGALVNWKNNPDGTRSPYEINVTYMDALSRRESSDEERCARFILAHAILLSFPGVPA
IYIQSILGSRNDYAGVEKLGYNRAINRKKYHSKEITRELNDEATLRHAVYHELSRLITLR
RSHNEFHPDNNFTIDTINSSVMRIPRSNADGNCLTGLFNVSKNIQHVNITNLHGRDLISE
VDILGNEITLRPWQVMWIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory