Comparing 15431 FitnessBrowser__Keio:15431 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
30% identity, 91% coverage: 8:274/293 of query aligns to 4:266/285 of 7cagA
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
32% identity, 91% coverage: 4:269/293 of query aligns to 24:288/313 of P94529
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
28% identity, 81% coverage: 55:290/293 of query aligns to 259:512/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
28% identity, 78% coverage: 55:282/293 of query aligns to 244:489/490 of 4ki0F
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
36% identity, 35% coverage: 187:288/293 of query aligns to 182:287/296 of P68183
>15431 FitnessBrowser__Keio:15431
MNRLFSGRSDMPFALLLLAPSLLLLGGLVAWPMVSNIEISFLRLPLNPNIESTFVGVSNY
VRILSDPGFWHSLWMTVWYTALVVAGSTVLGLAVAMFFNREFRLRKTARSLVILSYVTPS
ISLVFAWKYMFNNGYGIVNYLGVDLLHLYEQAPLWFDNPGSSFVLVVLFAIWRYFPYAFI
SFLAILQTIDKSLYEAAEMDGANAWQRFRIVTLPAIMPVLATVVTLRTIWMFYMFADVYL
LTTKVDILGVYLYKTAFAFNDLGKAAAISVVLFIIIFAVILLTRKRVNLNGNK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory