Comparing 15436 FitnessBrowser__Keio:15436 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
3wirA Crystal structure of kojibiose phosphorylase complexed with glucose (see paper)
32% identity, 94% coverage: 19:725/755 of query aligns to 20:752/756 of 3wirA
3wiqA Crystal structure of kojibiose phosphorylase complexed with kojibiose (see paper)
32% identity, 94% coverage: 19:724/755 of query aligns to 20:751/751 of 3wiqA
D6XZ22 1,2-alpha-glucosylglycerol phosphorylase; 2-O-alpha-glucosylglycerol phosphorylase; GGP; EC 2.4.1.332 from Bacillus selenitireducens (strain ATCC 700615 / DSM 15326 / MLS10) (see 2 papers)
30% identity, 94% coverage: 27:734/755 of query aligns to 36:757/761 of D6XZ22
4ktpA Crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with glucose (see paper)
30% identity, 94% coverage: 27:734/755 of query aligns to 36:757/767 of 4ktpA
4ktrA Crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with isofagomine and glycerol (see paper)
30% identity, 94% coverage: 27:734/755 of query aligns to 36:757/762 of 4ktrA
4ktpB Crystal structure of 2-o-alpha-glucosylglycerol phosphorylase in complex with glucose (see paper)
30% identity, 94% coverage: 27:734/755 of query aligns to 36:757/761 of 4ktpB
1h54B Maltose phosphorylase from lactobacillus brevis (see paper)
29% identity, 93% coverage: 22:720/755 of query aligns to 27:741/754 of 1h54B
8iucA Crystal structure of gh65 alpha-1,2-glucosidase from flavobacterium johnsoniae in complex with isomaltose (see paper)
26% identity, 89% coverage: 18:692/755 of query aligns to 16:645/659 of 8iucA
7fe4A Crystal structure of gh65 alpha-1,2-glucosidase from flavobacterium johnsoniae in complex with glucose (see paper)
26% identity, 89% coverage: 18:692/755 of query aligns to 16:645/659 of 7fe4A
Q32M88 Protein-glucosylgalactosylhydroxylysine glucosidase; Acid trehalase-like protein 1; EC 3.2.1.107 from Homo sapiens (Human) (see paper)
29% identity, 45% coverage: 262:604/755 of query aligns to 222:529/737 of Q32M88
Sites not aligning to the query:
P48016 Periplasmic acid trehalase ATH1; Alpha,alpha-trehalase; Alpha,alpha-trehalose glucohydrolase; EC 3.2.1.28 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
23% identity, 50% coverage: 254:631/755 of query aligns to 431:776/1211 of P48016
Sites not aligning to the query:
>15436 FitnessBrowser__Keio:15436
MTRPVTLSEPHFSQHTLNKYASLMAQGNGYLGLRASHEEDYTRQTRGMYLAGLYHRAGKG
EINELVNLPDVVGMEIAINGEVFSLSHEAWQRELDFASGELRRNVVWRTSNGSGYTIASR
RFVSADQLPLIALEITITPLDADASVLISTGIDATQTNHGRQHLDETQVRVFGQHLMQGS
YTTQDGRSDVAISCCCKVSGDVQQCYTAKERRLLQHTSAQLHAGETMTLQKLVWIDWRDD
RQAALDEWGSASLRQLEMCAQQSYDQLLAASTENWRQWWQKRRITVNGGEAHDQQALDYA
LYHLRIMTPAHDERSSIAAKGLTGEGYKGHVFWDTEVFLLPFHLFSDPTVARSLLRYRWH
NLPGAQEKARRNGWQGALFPWESARSGEEETPEFAAINIRTGLRQKVASAQAEHHLVADI
AWAVIQYWQTTGDESFIAHEGMALLLETAKFWISRAVRVNDRLEIHDVIGPDEYTEHVNN
NAYTSYMARYNVQQALNIARQFGCSDDAFIHRAEMFLKELWMPEIQPDGVLPQDDSFMAK
PAINLAKYKAAAGKQTILLDYSRAEVNEMQILKQADVVMLNYMLPEQFSAASCLANLQFY
EPRTIHDSSLSKAIHGIVAARCGLLTQSYQFWREGTEIDLGADPHSCDDGIHAAATGAIW
LGAIQGFAGVSVRDGELHLNPALPEQWQQLSFPLFWQGCELQVTLDAQRIAIRTSAPVSL
RLNGQLITVAEESVFCLGDFILPFNGTATKHQEDE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory