Comparing 15458 FitnessBrowser__Keio:15458 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
4ewtA The crystal structure of a putative aminohydrolase from methicillin resistant staphylococcus aureus (see paper)
28% identity, 83% coverage: 71:430/436 of query aligns to 23:387/389 of 4ewtA
P54955 N-acetylcysteine deacetylase; S-(2-succino)cysteine metabolism operon protein P; EC 3.5.1.- from Bacillus subtilis (strain 168)
29% identity, 76% coverage: 96:428/436 of query aligns to 53:373/380 of P54955
P54968 IAA-amino acid hydrolase ILR1; EC 3.5.1.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 96% coverage: 13:430/436 of query aligns to 46:426/442 of P54968
O04373 IAA-amino acid hydrolase ILR1-like 4; jasmonoyl-L-amino acid hydrolase; EC 3.5.1.-; EC 3.5.1.127 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 91% coverage: 19:416/436 of query aligns to 52:408/440 of O04373
6slfA Nalpha-acylglutamine aminoacylase from corynebacterium sp.Releasing human axilla odorants co-crystallised with high affinity inhibitor (see paper)
27% identity, 87% coverage: 2:380/436 of query aligns to 3:344/398 of 6slfA
Sites not aligning to the query:
3ramA Crystal structure of hmra (see paper)
26% identity, 63% coverage: 57:331/436 of query aligns to 25:273/391 of 3ramA
Sites not aligning to the query:
1cg2A Carboxypeptidase g2 (see paper)
28% identity, 49% coverage: 105:317/436 of query aligns to 76:283/389 of 1cg2A
Sites not aligning to the query:
P06621 Carboxypeptidase G2; CPDG2; Folate hydrolase G2; Glutamate carboxypeptidase; Pteroylmonoglutamic acid hydrolase G2; Glucarpidase; EC 3.4.17.11 from Pseudomonas sp. (strain RS-16) (see paper)
28% identity, 49% coverage: 105:317/436 of query aligns to 101:308/415 of P06621
Sites not aligning to the query:
7m6uB Crystal structure of a circular permutation and computationally designed pro-enzyme of carboxypeptidase g2 (see paper)
28% identity, 49% coverage: 105:317/436 of query aligns to 11:218/392 of 7m6uB
Sites not aligning to the query:
7yh4A Crystal structure of human cytosolic beta-alanyl lysine dipeptidase (pm20d2)
25% identity, 48% coverage: 124:333/436 of query aligns to 79:290/400 of 7yh4A
Sites not aligning to the query:
>15458 FitnessBrowser__Keio:15458
MESLNQFVNSLAPKLSHWRRDFHHYAESGWVEFRTATLVAEELHQLGYSLALGREVVNES
SRMGLPDEFTLQREFERARQQGALAQWIAAFEGGFTGIVATLDTGRPGPVMAFRVDMDAL
DLSEEQDVSHRPYRDGFASCNAGMMHACGHDGHTAIGLGLAHTLKQFESGLHGVIKLIFQ
PAEEGTRGARAMVDAGVVDDVDYFTAVHIGTGVPAGTVVCGSDNFMATTKFDAHFTGTAA
HAGAKPEDGHNALLAAAQATLALHAIAPHSEGASRVNVGVMQAGSGRNVVPASALLKVET
RGASDVINQYVFDRAQQAIQGAATMYGVGVETRLMGAATASSPSPQWVAWLQSQAAQVAG
VNQAIERVEAPAGSEDATLMMARVQQHQGQASYVVFGTQLAAGHHNEKFDFDEQVLAIAV
ETLARTALNFPWTRGI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory