Comparing 15510 FitnessBrowser__Keio:15510 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P76077 1,2-phenylacetyl-CoA epoxidase, subunit A; 1,2-phenylacetyl-CoA epoxidase, catalytic subunit alpha; 1,2-phenylacetyl-CoA monooxygenase, subunit A; EC 1.14.13.149 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:309/309 of query aligns to 1:309/309 of P76077
3pw1A The phenylacetyl-coa monooxygenase paaac subcomplex with phenylacetyl- coa (see paper)
100% identity, 97% coverage: 2:302/309 of query aligns to 4:304/304 of 3pw1A
3pvyA The phenylacetyl-coa monooxygenase paaac subcomplex with coenzyme a (see paper)
100% identity, 97% coverage: 2:302/309 of query aligns to 4:304/304 of 3pvyA
3pvtA The phenylacetyl-coa monooxygenase paaac subcomplex with 3- hydroxybutanoyl-coa (see paper)
100% identity, 97% coverage: 2:302/309 of query aligns to 4:304/304 of 3pvtA
3pw8C The phenylacetyl-coa monooxygenase paaac subcomplex with acetyl-coa (see paper)
100% identity, 97% coverage: 2:302/309 of query aligns to 1:301/301 of 3pw8C
4ii4A The phenylacetyl-coa monooxygenase - mutant paaa e49q k68q - paac wild type subcomplex with benzoyl-coa
99% identity, 97% coverage: 2:302/309 of query aligns to 4:304/304 of 4ii4A
>15510 FitnessBrowser__Keio:15510
MTQEERFEQRIAQETAIEPQDWMPDAYRKTLIRQIGQHAHSEIVGMLPEGNWITRAPTLR
RKAILLAKVQDEAGHGLYLYSAAETLGCAREDIYQKMLDGRMKYSSIFNYPTLSWADIGV
IGWLVDGAAIVNQVALCRTSYGPYARAMVKICKEESFHQRQGFEACMALAQGSEAQKQML
QDAINRFWWPALMMFGPNDDNSPNSARSLTWKIKRFTNDELRQRFVDNTVPQVEMLGMTV
PDPDLHFDTESGHYRFGEIDWQEFNEVINGRGICNQERLDAKRKAWEEGTWVREAALAHA
QKQHARKVA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory