Comparing 15514 FitnessBrowser__Keio:15514 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ylrA Structure of a bacteria protein
27% identity, 84% coverage: 36:335/356 of query aligns to 36:311/326 of 7ylrA
Sites not aligning to the query:
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
33% identity, 37% coverage: 39:168/356 of query aligns to 45:173/243 of 2eixA
Sites not aligning to the query:
P0A3C7 Ferredoxin-1; Ferredoxin I from Nostoc sp. (strain PCC 7120 / SAG 25.82 / UTEX 2576) (see paper)
48% identity, 24% coverage: 263:348/356 of query aligns to 5:90/99 of P0A3C7
Sites not aligning to the query:
1ewyC Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
48% identity, 24% coverage: 263:348/356 of query aligns to 4:89/98 of 1ewyC
1czpA Anabaena pcc7119 [2fe-2s] ferredoxin in the reduced and oxixized state at 1.17 a (see paper)
48% identity, 24% coverage: 263:348/356 of query aligns to 4:89/98 of 1czpA
7s3dX Structure of photosystem i with bound ferredoxin from synechococcus sp. Pcc 7335 acclimated to far-red light (see paper)
46% identity, 24% coverage: 263:348/356 of query aligns to 3:88/97 of 7s3dX
3b2gA Leptolyngbya boryana ferredoxin (see paper)
51% identity, 19% coverage: 280:348/356 of query aligns to 22:89/98 of 3b2gA
Q8IED5 Ferredoxin, apicoplast from Plasmodium falciparum (isolate 3D7) (see paper)
35% identity, 28% coverage: 252:349/356 of query aligns to 86:184/194 of Q8IED5
6iriA Crystal structure of the minor ferredoxin from thermosynechococcus elongatus (see paper)
44% identity, 23% coverage: 268:348/356 of query aligns to 17:95/107 of 6iriA
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
24% identity, 59% coverage: 35:244/356 of query aligns to 43:244/250 of 1tvcA
Sites not aligning to the query:
P00250 Ferredoxin-1; Ferredoxin I from Aphanothece sacrum (see 2 papers)
43% identity, 24% coverage: 263:349/356 of query aligns to 5:89/97 of P00250
Sites not aligning to the query:
1rfkB Crystal structure of 2fe2s ferredoxin from thermophilic cyanobacterium mastigocladus laminosus (see paper)
49% identity, 20% coverage: 280:349/356 of query aligns to 22:90/97 of 1rfkB
3av8A Refined structure of plant-type [2fe-2s] ferredoxin i from aphanothece sacrum at 1.46 a resolution (see paper)
43% identity, 24% coverage: 263:349/356 of query aligns to 4:89/97 of 3av8A
1cnfA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
29% identity, 49% coverage: 5:180/356 of query aligns to 4:196/260 of 1cnfA
Sites not aligning to the query:
3ab5A Crystal structure of the 2fe 2s ferredoxin from cyanidioschyzon merolae
46% identity, 20% coverage: 279:348/356 of query aligns to 20:88/97 of 3ab5A
1cneA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
29% identity, 49% coverage: 5:180/356 of query aligns to 4:196/260 of 1cneA
Sites not aligning to the query:
6xtfD Crystal structure a thioredoxin reductase from gloeobacter violaceus bound to its electron donor (see paper)
44% identity, 23% coverage: 263:344/356 of query aligns to 4:84/96 of 6xtfD
7y5eNN Phycobilisome 31.8 kDa linker polypeptide, phycoerythrin-associated, rod (see paper)
49% identity, 20% coverage: 279:348/356 of query aligns to 22:90/99 of 7y5eNN
1iueA Crystal structure analysis of ferredoxin from plasmodium falciparum
37% identity, 24% coverage: 264:349/356 of query aligns to 5:88/98 of 1iueA
6khi1 Supercomplex for cylic electron transport in cyanobacteria (see paper)
45% identity, 22% coverage: 263:341/356 of query aligns to 5:83/98 of 6khi1
>15514 FitnessBrowser__Keio:15514
MTTFHSLTVAKVESETRDAVTITFAVPQPLQEAYRFRPGQHLTLKASFDGEELRRCYSIC
RSYLPGEISVAVKAIEGGRFSRYAREHIRQGMTLEVMVPQGHFGYQPQAERQGRYLAIAA
GSGITPMLAIIATTLQTEPESQFTLIYGNRTSQSMMFRQALADLKDKYPQRLQLLCIFSQ
ETLDSDLLHGRIDGEKLQSLGASLINFRLYDEAFICGPAAMMDDAETALKALGMPDKTIH
LERFNTPGTRVKRSVNVQSDGQKVTVRQDGRDREIVLNADDESILDAALRQGADLPYACK
GGVCATCKCKVLRGKVAMETNYSLEPDELAAGYVLSCQALPLTSDVVVDFDAKGMA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory