Comparing 15604 FitnessBrowser__Keio:15604 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
31% identity, 93% coverage: 5:289/308 of query aligns to 3:307/330 of P0AAH4
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
33% identity, 88% coverage: 29:299/308 of query aligns to 21:310/326 of Q8RDH4
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
39% identity, 67% coverage: 42:246/308 of query aligns to 29:247/253 of 7z15I
Sites not aligning to the query:
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
39% identity, 67% coverage: 42:246/308 of query aligns to 29:247/250 of 7z18I
Sites not aligning to the query:
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
38% identity, 67% coverage: 42:246/308 of query aligns to 29:247/250 of 7z16I
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
33% identity, 88% coverage: 29:299/308 of query aligns to 20:299/310 of 4fwiB
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 79% coverage: 5:246/308 of query aligns to 1:239/240 of 4ymuJ
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 80% coverage: 26:271/308 of query aligns to 15:267/343 of P30750
Sites not aligning to the query:
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
32% identity, 71% coverage: 29:247/308 of query aligns to 19:247/375 of 2d62A
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 80% coverage: 26:271/308 of query aligns to 16:268/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 80% coverage: 26:271/308 of query aligns to 16:268/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 80% coverage: 26:271/308 of query aligns to 16:268/344 of 6cvlD
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
33% identity, 78% coverage: 5:243/308 of query aligns to 2:236/241 of 4u00A
1g291 Malk (see paper)
32% identity, 73% coverage: 24:247/308 of query aligns to 11:244/372 of 1g291
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
32% identity, 78% coverage: 6:246/308 of query aligns to 1:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
32% identity, 78% coverage: 6:246/308 of query aligns to 1:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
32% identity, 78% coverage: 6:246/308 of query aligns to 1:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
32% identity, 78% coverage: 6:246/308 of query aligns to 1:241/242 of 2oljA
1vciA Crystal structure of the atp-binding cassette of multisugar transporter from pyrococcus horikoshii ot3 complexed with atp (see paper)
33% identity, 69% coverage: 22:234/308 of query aligns to 12:220/353 of 1vciA
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
29% identity, 74% coverage: 19:245/308 of query aligns to 29:265/382 of 7ahhC
Sites not aligning to the query:
>15604 FitnessBrowser__Keio:15604
MSDTLLTLRDVHINFPARKNWLGKTTEHVHAINGIDLQIRRGETLGIVGESGCGKSTLAQ
LLMGMLQPSHGQYIRSGSQRIMQMVFQDPLSSLNPRLPVWRIITEPLWIAKRSSEQQRRA
LAEELAVQVGIRPEYLDRLPHAFSGGQRQRIAIARALSSQPDVIVLDEPTSALDISVQAQ
ILNLLVTLQENHGLTYVLISHNVSVIRHMSDRVAVMYLGQIVELGDAQQVLTAPAHPYTR
LLLDSLPAIDKPLEEEWALRKTDLPGNRTLPQGCFFYERCPLATHGCEVRQSLAIREDGR
ELRCWRAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory