Comparing 15637 FitnessBrowser__Keio:15637 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
88% identity, 93% coverage: 26:340/340 of query aligns to 2:316/316 of 1tjyA
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
87% identity, 92% coverage: 27:340/340 of query aligns to 1:314/314 of 3t95A
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
81% identity, 92% coverage: 29:340/340 of query aligns to 3:315/315 of 3ejwA
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
63% identity, 92% coverage: 29:340/340 of query aligns to 9:321/321 of 4pz0A
6dspA Lsrb from clostridium saccharobutylicum in complex with ai-2 (see paper)
44% identity, 91% coverage: 30:340/340 of query aligns to 3:326/326 of 6dspA
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
31% identity, 63% coverage: 48:261/340 of query aligns to 21:231/313 of 2h3hA
Sites not aligning to the query:
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
31% identity, 63% coverage: 48:261/340 of query aligns to 21:231/305 of 3c6qC
Sites not aligning to the query:
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
26% identity, 74% coverage: 31:283/340 of query aligns to 8:264/321 of 4wzzA
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
30% identity, 59% coverage: 30:230/340 of query aligns to 9:205/289 of 5hqjA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
25% identity, 70% coverage: 23:260/340 of query aligns to 2:237/283 of 6gt9A
Sites not aligning to the query:
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
25% identity, 69% coverage: 27:260/340 of query aligns to 1:232/278 of 6guqA
Sites not aligning to the query:
4ry8B Crystal structure of 5-methylthioribose transporter solute binding protein tlet_1677 from thermotoga lettingae tmo target efi-511109 in complex with 5-methylthioribose
36% identity, 26% coverage: 29:116/340 of query aligns to 11:97/321 of 4ry8B
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
26% identity, 80% coverage: 29:299/340 of query aligns to 2:272/290 of 4wutA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
24% identity, 72% coverage: 41:284/340 of query aligns to 14:253/274 of 2ioyA
Sites not aligning to the query:
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
31% identity, 37% coverage: 36:160/340 of query aligns to 16:138/287 of 7x0hA
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
25% identity, 75% coverage: 29:282/340 of query aligns to 4:260/287 of 5dteB
4rxtA Crystal structure of carbohydrate transporter solute binding protein arad_9553 from agrobacterium radiobacter, target efi-511541, in complex with d-arabinose
24% identity, 70% coverage: 48:284/340 of query aligns to 25:265/295 of 4rxtA
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
24% identity, 76% coverage: 27:284/340 of query aligns to 2:256/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
24% identity, 76% coverage: 27:284/340 of query aligns to 2:256/287 of 4ry0A
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
23% identity, 68% coverage: 29:260/340 of query aligns to 8:247/303 of 5dkvA
Sites not aligning to the query:
>15637 FitnessBrowser__Keio:15637
MTLHRFKKIALLSALGIAAISMNVQAAERIAFIPKLVGVGFFTSGGNGAQQAGKELGVDV
TYDGPTEPSVSGQVQLINNFVNQGYNAIIVSAVSPDGLCPALKRAMQRGVRVLTWDSDTK
PECRSYYINQGTPAQLGGMLVDMAARQVNKDKAKVAFFYSSPTVTDQNQWVKEAKAKIAK
EHPGWEIVTTQFGYNDATKSLQTAEGILKAYSDLDAIIAPDANALPAAAQAAENLKNDKV
AIVGFSTPNVMRPYVERGTVKEFGLWDVVQQGKISVYVADALLKKGSMKTGDKLDIKGVG
QVEVSPNSVQGYDYEADGNGIVLLPERVIFNKENIGKYDF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory