SitesBLAST
Comparing 15701 FitnessBrowser__Keio:15701 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
97% identity, 99% coverage: 1:337/339 of query aligns to 4:337/337 of 4ilkA
- active site: C40 (= C37), G41 (= G38), S42 (= S39), H45 (= H42), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), A107 (= A107), P145 (= P145), A149 (= A149), K332 (= K332)
- binding manganese (ii) ion: C40 (= C37), H59 (= H59), E60 (= E60), E144 (= E144)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G168), G170 (= G170), P171 (= P171), I172 (= I172), D193 (= D193), R194 (= R194), R198 (= R198), N213 (= N213), A235 (= A235), A236 (= A236), C237 (= C237), I241 (= I241), M258 (= M258), F260 (= F260)
- binding zinc ion: C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103)
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
35% identity, 96% coverage: 1:324/339 of query aligns to 3:334/346 of 2dfvA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (= H42), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), K113 (≠ A107), P151 (= P145), A155 (= A149)
- binding nicotinamide-adenine-dinucleotide: G175 (= G170), P176 (= P171), L177 (≠ I172), E197 (≠ D193), P198 (≠ R194), R202 (= R198), F241 (≠ A235), S242 (≠ A236), A244 (≠ H238), L264 (≠ M258), G265 (= G259), L266 (≠ F260), I289 (vs. gap), T290 (≠ S281)
- binding zinc ion: C95 (= C89), C101 (= C95), C109 (= C103)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
35% identity, 96% coverage: 1:324/339 of query aligns to 5:336/348 of O58389
- C42 (= C37) binding
- T44 (≠ S39) mutation to A: Total loss of enzymatic activity.
- H67 (= H59) binding
- E68 (= E60) binding
- C97 (= C89) binding
- C100 (= C92) binding
- C103 (= C95) binding
- C111 (= C103) binding
- E152 (= E144) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I172) binding
- E199 (≠ D193) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R198) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ MGF 258:260) binding
- IT 291:292 (≠ -S 281) binding
- R294 (= R283) mutation to A: 4000-fold decrease in catalytic efficiency.
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
33% identity, 96% coverage: 1:324/339 of query aligns to 5:336/350 of Q5JI69
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
33% identity, 96% coverage: 1:324/339 of query aligns to 3:334/347 of 3gfbA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (= H42), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), K113 (≠ A107), P151 (= P145), A155 (= A149)
- binding nicotinamide-adenine-dinucleotide: G173 (= G168), G175 (= G170), P176 (= P171), L177 (≠ I172), S196 (≠ A192), E197 (≠ D193), P198 (≠ R194), R202 (= R198), F241 (≠ A235), S242 (≠ A236), A244 (≠ H238), L264 (≠ M258), G265 (= G259), L266 (vs. gap), I289 (≠ F280), T290 (≠ S281)
Sites not aligning to the query:
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
30% identity, 99% coverage: 3:339/339 of query aligns to 4:348/348 of 1e3jA
- active site: C38 (= C37), G39 (= G38), S40 (= S39), H43 (= H42), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C99 (= C95), C107 (= C103), T111 (≠ A107), P150 (= P145), G154 (≠ A149), K341 (= K332)
- binding phosphate ion: A174 (= A169), A196 (≠ D193), R197 (= R194), S198 (≠ I195), R201 (= R198)
- binding zinc ion: C38 (= C37), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C99 (= C95), C107 (= C103)
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
30% identity, 99% coverage: 1:335/339 of query aligns to 1:339/343 of 2ejvA
- active site: C38 (= C37), G39 (= G38), T40 (≠ S39), H43 (= H42), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C99 (= C95), C107 (= C103), Q111 (≠ A107), P149 (= P145), A153 (= A149), K336 (= K332)
- binding nicotinamide-adenine-dinucleotide: G172 (= G168), G174 (= G170), P175 (= P171), I176 (= I172), S195 (≠ A192), D196 (= D193), P197 (≠ R194), R201 (= R198), F238 (≠ A235), S239 (≠ A236), N241 (≠ H238), A244 (≠ I241), L261 (≠ M258), G262 (= G259), I263 (≠ F260)
- binding zinc ion: C38 (= C37), H63 (= H59), E64 (= E60), C96 (= C92), C99 (= C95), C107 (= C103)
2dq4A Crystal structure of threonine 3-dehydrogenase
30% identity, 99% coverage: 1:335/339 of query aligns to 1:339/343 of 2dq4A
- active site: C38 (= C37), G39 (= G38), T40 (≠ S39), H43 (= H42), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C99 (= C95), C107 (= C103), Q111 (≠ A107), P149 (= P145), A153 (= A149), K336 (= K332)
- binding zinc ion: C38 (= C37), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C107 (= C103)
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
30% identity, 99% coverage: 1:335/339 of query aligns to 1:339/343 of Q5SKS4
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
29% identity, 95% coverage: 1:321/339 of query aligns to 4:328/343 of 4ej6A
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (= H42), H61 (= H59), E62 (= E60), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), R109 (≠ A107), P147 (= P145), C151 (≠ A149)
- binding zinc ion: C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103)
Sites not aligning to the query:
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
29% identity, 95% coverage: 1:321/339 of query aligns to 4:328/342 of 4ejmA
- active site: C40 (= C37), G41 (= G38), T42 (≠ S39), H45 (= H42), H61 (= H59), E62 (= E60), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), R109 (≠ A107), P147 (= P145), C151 (≠ A149)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G168), G172 (= G170), V173 (≠ P171), I174 (= I172), T194 (≠ D193), R195 (= R194), Q196 (≠ I195), K199 (≠ R198), C240 (≠ A235), E245 (≠ S240), T246 (≠ I241), L263 (≠ M258), V265 (≠ F260), I291 (≠ L284)
- binding zinc ion: C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103)
Sites not aligning to the query:
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
30% identity, 89% coverage: 18:320/339 of query aligns to 17:328/341 of P07913
- C38 (= C37) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
4uejA Closed state of galactitol-1-phosphate 5-dehydrogenase from e. Coli in complex with glycerol. (see paper)
32% identity, 94% coverage: 1:320/339 of query aligns to 1:330/346 of 4uejA
- active site: C38 (= C37), G39 (= G38), S40 (= S39), P43 (≠ S41), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), D107 (≠ A107), P145 (= P145), G149 (≠ A149)
- binding glycerol: H59 (= H59), E144 (= E144)
- binding zinc ion: C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103)
Sites not aligning to the query:
4a2cA Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli (see paper)
32% identity, 94% coverage: 1:320/339 of query aligns to 1:330/346 of 4a2cA
- active site: C38 (= C37), G39 (= G38), S40 (= S39), P43 (≠ S41), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), D107 (≠ A107), P145 (= P145), G149 (≠ A149)
- binding zinc ion: C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103)
Sites not aligning to the query:
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
27% identity, 99% coverage: 5:339/339 of query aligns to 7:347/347 of 5vm2A
- active site: C39 (= C37), G40 (= G38), S41 (= S39), H44 (= H42), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), D113 (≠ A107), P153 (= P145), G157 (≠ A149), K340 (= K332)
- binding magnesium ion: H65 (= H59), E66 (= E60), E152 (= E144)
- binding zinc ion: C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103)
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
31% identity, 90% coverage: 18:322/339 of query aligns to 23:342/357 of 7y9pA
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
28% identity, 95% coverage: 3:325/339 of query aligns to 11:340/357 of Q00796
- C45 (= C37) binding
- H70 (= H59) binding
- E71 (= E60) binding
- R110 (≠ K99) to P: in SORDD; results in protein aggregation
- H135 (≠ V123) to R: in SORDD; results in protein aggregation
- A153 (≠ V141) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I172) binding
- D204 (= D193) binding
- R209 (= R198) binding
- Q239 (≠ E224) to L: in dbSNP:rs1042079
- N269 (≠ R254) to T: in dbSNP:rs930337
- VGL 273:275 (≠ MGF 258:260) binding
- VFR 297:299 (≠ SRL 282:284) binding
- V322 (≠ I307) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
28% identity, 95% coverage: 3:325/339 of query aligns to 10:339/356 of 1pl6A
- active site: C44 (= C37), G45 (= G38), S46 (= S39), H49 (= H42), H69 (= H59), E70 (= E60), R99 (≠ C89), D102 (≠ C92), C105 (= C95), S113 (≠ C103), F117 (≠ A107), P156 (= P145), G160 (≠ A149)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C37), S46 (= S39), I56 (≠ G46), F59 (≠ P49), H69 (= H59), E155 (= E144), L274 (≠ F260), F297 (≠ R283)
- binding nicotinamide-adenine-dinucleotide: G181 (= G170), P182 (= P171), I183 (= I172), D203 (= D193), L204 (≠ R194), R208 (= R198), C249 (≠ A235), T250 (≠ A236), V272 (≠ M258), G273 (= G259), L274 (≠ F260), F297 (≠ R283), R298 (≠ L284)
- binding zinc ion: C44 (= C37), H69 (= H59)
Sites not aligning to the query:
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
29% identity, 99% coverage: 1:336/339 of query aligns to 1:344/346 of 4cpdA
- active site: C38 (= C37), G39 (= G38), S40 (= S39), H43 (= H42), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), G107 (≠ A107), D152 (≠ E144), T156 (≠ I148), K340 (= K332)
- binding nicotinamide-adenine-dinucleotide: G39 (= G38), S40 (= S39), T156 (≠ I148), G178 (= G170), P179 (= P171), V180 (≠ I172), D200 (= D193), R201 (= R194), R205 (= R198), A243 (= A235), V244 (≠ A236), V266 (≠ M258), V268 (≠ F260), L292 (≠ R283), A293 (≠ L284), F333 (= F323)
- binding zinc ion: C38 (= C37), H59 (= H59), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), D152 (≠ E144)
6dkhC The crystal structure of l-idonate 5-dehydrogenase from escherichia coli str. K-12 substr. Mg1655
27% identity, 99% coverage: 2:337/339 of query aligns to 9:346/346 of 6dkhC
Query Sequence
>15701 FitnessBrowser__Keio:15701
MKSILIEKPNQLAIVEREIPTPSAGEVRVKVKLAGICGSDSHIYRGHNPFAKYPRVIGHE
FFGVIDAVGEGVESARVGERVAVDPVVSCGHCYPCSIGKPNVCTTLAVLGVHADGGFSEY
AVVPAKNAWKIPEAVADQYAVMIEPFTIAANVTGHGQPTENDTVLVYGAGPIGLTIVQVL
KGVYNVKNVIVADRIDERLEKAKESGADWAINNSQTPLGEIFTEKGIKPTLIIDAACHPS
ILKEAVTLASPAARIVLMGFSSEPSEVIQQGITGKELSIFSSRLNANKFPIVIDWLSKGL
IKPEKLITHTFDFQHVADAISLFEQDQKHCCKVLLTFSE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory