Comparing 15772 FitnessBrowser__Keio:15772 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AC81 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:135/135 of query aligns to 1:135/135 of P0AC81
1fa6A Crystal structure of the co(ii)-bound glyoxalase i of escherichia coli (see paper)
100% identity, 93% coverage: 1:126/135 of query aligns to 1:126/128 of 1fa6A
1fa5A Crystal structure of the zn(ii)-bound glyoxalase i of escherichia coli (see paper)
100% identity, 93% coverage: 1:126/135 of query aligns to 1:126/128 of 1fa5A
6bnnA Crystal structure of v278e-glyoxalase i mutant from zea mays in space group p4(1)2(1)2 (see paper)
54% identity, 98% coverage: 2:133/135 of query aligns to 16:147/282 of 6bnnA
Sites not aligning to the query:
5d7zA Crystal structure of glyoxalase i from zea mays (see paper)
54% identity, 98% coverage: 2:133/135 of query aligns to 10:141/281 of 5d7zA
Sites not aligning to the query:
4mttA Ni- and zn-bound gloa2 at low resolution (see paper)
53% identity, 93% coverage: 1:126/135 of query aligns to 1:126/128 of 4mttA
Q948T6 Lactoylglutathione lyase; Aldoketomutase; Allergen Glb33; Glyoxalase I; Glx I; Glyoxylase I 11; OsGLYI-11; OsGLYI11; Ketone-aldehyde mutase; Methylglyoxalase; PP33; S-D-lactoylglutathione methylglyoxal lyase; Allergen Ory s Glyoxalase I; EC 4.4.1.5 from Oryza sativa subsp. japonica (Rice) (see paper)
54% identity, 92% coverage: 2:125/135 of query aligns to 24:148/291 of Q948T6
Sites not aligning to the query:
2c21A Specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme (see paper)
52% identity, 93% coverage: 2:127/135 of query aligns to 3:123/139 of 2c21A
P50107 Glyoxalase I; Glx I; Aldoketomutase; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; actoylglutathione lyase; EC 4.4.1.5 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
42% identity, 91% coverage: 2:124/135 of query aligns to 182:320/326 of P50107
Sites not aligning to the query:
Q04760 Lactoylglutathione lyase; Aldoketomutase; Glyoxalase I; Glx I; Ketone-aldehyde mutase; Methylglyoxalase; S-D-lactoylglutathione methylglyoxal lyase; EC 4.4.1.5 from Homo sapiens (Human) (see 12 papers)
34% identity, 90% coverage: 3:124/135 of query aligns to 32:175/184 of Q04760
Sites not aligning to the query:
7wt0A Human glyoxalase i (with c-ter his tag) in complex with tlsc702 (see paper)
34% identity, 90% coverage: 3:124/135 of query aligns to 31:174/185 of 7wt0A
Sites not aligning to the query:
3w0uA Human glyoxalase i with an n-hydroxypyridone inhibitor
34% identity, 90% coverage: 3:124/135 of query aligns to 24:167/175 of 3w0uA
Sites not aligning to the query:
3w0tA Human glyoxalase i with an n-hydroxypyridone derivative inhibitor
34% identity, 90% coverage: 3:124/135 of query aligns to 24:167/176 of 3w0tA
Sites not aligning to the query:
3vw9A Human glyoxalase i with an n-hydroxypyridone inhibitor (see paper)
34% identity, 90% coverage: 3:124/135 of query aligns to 24:167/176 of 3vw9A
Sites not aligning to the query:
1qipA Human glyoxalase i complexed with s-p- nitrobenzyloxycarbonylglutathione (see paper)
34% identity, 90% coverage: 3:124/135 of query aligns to 24:167/176 of 1qipA
Sites not aligning to the query:
1qinA Human glyoxalase i complexed with s-(n-hydroxy-n-p- iodophenylcarbamoyl) glutathione (see paper)
34% identity, 90% coverage: 3:124/135 of query aligns to 24:167/176 of 1qinA
Sites not aligning to the query:
1froA Human glyoxalase i with benzyl-glutathione inhibitor (see paper)
34% identity, 90% coverage: 3:124/135 of query aligns to 24:167/176 of 1froA
Sites not aligning to the query:
7wszA Human glyoxalase i (with c-ter his tag) in glycerol-bound form (see paper)
34% identity, 90% coverage: 3:124/135 of query aligns to 24:167/183 of 7wszA
Sites not aligning to the query:
4opnA Crystal structure of mouse glyoxalase i complexed with mah
33% identity, 90% coverage: 3:124/135 of query aligns to 24:167/172 of 4opnA
Sites not aligning to the query:
4kyhA Crystal structure of mouse glyoxalase i complexed with zopolrestat (see paper)
33% identity, 90% coverage: 3:124/135 of query aligns to 27:170/177 of 4kyhA
>15772 FitnessBrowser__Keio:15772
MRLLHTMLRVGDLQRSIDFYTKVLGMKLLRTSENPEYKYSLAFVGYGPETEEAVIELTYN
WGVDKYELGTAYGHIALSVDNAAEACEKIRQNGGNVTREAGPVKGGTTVIAFVEDPDGYK
IELIEEKDAGRGLGN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory