SitesBLAST
Comparing 15817 FitnessBrowser__Keio:15817 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
5ol2A The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
33% identity, 81% coverage: 60:311/312 of query aligns to 70:325/331 of 5ol2A
- binding calcium ion: E75 (= E65), D188 (≠ R173)
- binding flavin-adenine dinucleotide: T117 (≠ V107), R136 (≠ H124), I147 (≠ A133), G216 (= G201), R217 (= R202), G218 (= G203), S242 (= S227), R243 (= R228), A244 (≠ P229), Q256 (≠ Y242), V257 (≠ I243), G258 (= G244), T260 (≠ S246), G273 (= G259), I274 (= I260), S275 (= S261), A277 (≠ Q263), Q279 (= Q265), H280 (= H266), N294 (= N280), K295 (= K281), D312 (= D298), V313 (≠ I299)
7qh2A Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
29% identity, 94% coverage: 19:311/312 of query aligns to 30:332/337 of 7qh2A
- binding flavin-adenine dinucleotide: L125 (= L106), T126 (≠ V107), R144 (= R125), I155 (vs. gap), R224 (= R202), G225 (= G203), T249 (≠ S227), R250 (= R228), Q263 (≠ Y242), I264 (= I243), G265 (= G244), L266 (≠ V245), S267 (= S246), G280 (= G259), I281 (= I260), S282 (= S261), Q286 (= Q265), N301 (= N280), S302 (≠ K281), D303 (= D282), D319 (= D298), L320 (≠ I299)
6fahE Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
31% identity, 100% coverage: 1:312/312 of query aligns to 62:390/393 of 6fahE
- binding flavin-adenine dinucleotide: L180 (= L106), R200 (≠ H124), M281 (≠ R202), G282 (= G203), R307 (= R228), A308 (≠ P229), Q320 (≠ Y242), V321 (≠ I243), G322 (= G244), Q323 (≠ V245), T324 (≠ S246), G337 (= G259), I338 (= I260), S339 (= S261), Q343 (= Q265), H344 (= H266), N358 (= N280), K359 (= K281), L377 (≠ I299)
Sites not aligning to the query:
- binding iron/sulfur cluster: 7, 10, 13, 17, 18, 35, 36, 37, 38, 41, 45, 49
5ow0A Crystal structure of an electron transfer flavoprotein from geobacter metallireducens (see paper)
32% identity, 98% coverage: 4:310/312 of query aligns to 1:291/292 of 5ow0A
- binding flavin-adenine dinucleotide: G183 (= G201), R184 (= R202), G185 (= G203), S209 (= S227), R210 (= R228), Q223 (≠ Y242), I224 (= I243), G225 (= G244), T227 (≠ S246), G240 (= G259), V241 (≠ I260), S242 (= S261), A244 (≠ Q263), Q246 (= Q265), H247 (= H266), N261 (= N280), K262 (= K281), D279 (= D298), Y280 (≠ I299)
P13804 Electron transfer flavoprotein subunit alpha, mitochondrial; Alpha-ETF from Homo sapiens (Human) (see 6 papers)
31% identity, 72% coverage: 87:312/312 of query aligns to 112:332/333 of P13804
- G116 (= G91) to R: in GA2A; impaired protein stability and loss of electron transfer activity; dbSNP:rs119458971
- T171 (≠ V150) to I: decreased protein stability; dbSNP:rs1801591
- R223 (= R202) binding
- S248 (= S227) binding
- R249 (= R228) mutation to A: Loss of electron transfer activity.
- VGQT 263:266 (≠ IGVS 243:246) binding
- T266 (≠ S246) to M: in GA2A; decreased electron transfer activity; dbSNP:rs119458970
- SGAIQH 281:286 (≠ SGQIQH 261:266) binding
- N300 (= N280) binding
- DL 318:319 (≠ DI 298:299) binding
Sites not aligning to the query:
- 20:204 Domain I
- 205:333 Domain II
2a1uA Crystal structure of the human etf e165betaa mutant (see paper)
31% identity, 72% coverage: 87:312/312 of query aligns to 94:314/315 of 2a1uA
- binding flavin-adenine dinucleotide: G204 (= G201), R205 (= R202), S230 (= S227), R231 (= R228), A232 (≠ P229), Q244 (≠ Y242), V245 (≠ I243), G246 (= G244), T248 (≠ S246), G261 (= G259), I262 (= I260), S263 (= S261), A265 (≠ Q263), Q267 (= Q265), H268 (= H266), N282 (= N280), K283 (= K281), D300 (= D298), L301 (≠ I299)
4kpuA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
29% identity, 94% coverage: 19:310/312 of query aligns to 30:332/338 of 4kpuA
- binding flavin-adenine dinucleotide: L125 (= L106), R144 (≠ H124), I155 (≠ A133), G224 (= G201), R225 (= R202), G226 (= G203), S250 (= S227), R251 (= R228), A252 (≠ P229), Q264 (≠ Y242), V265 (≠ I243), G266 (= G244), Q267 (≠ V245), S268 (= S246), G281 (= G259), I282 (= I260), S283 (= S261), S285 (≠ Q263), Q287 (= Q265), H288 (= H266), N302 (= N280), K303 (= K281), D320 (= D298), A321 (≠ I299)
7koeB Electron bifurcating flavoprotein fix/etfabcx (see paper)
33% identity, 84% coverage: 50:310/312 of query aligns to 64:327/336 of 7koeB
- binding flavin-adenine dinucleotide: T121 (≠ V107), R140 (= R125), T142 (≠ M126), G219 (= G201), K220 (≠ R202), G221 (= G203), S245 (= S227), R246 (= R228), A247 (≠ P229), Q259 (≠ Y242), V260 (≠ I243), G261 (= G244), Q262 (≠ V245), T263 (≠ S246), G276 (= G259), S278 (= S261), Q282 (= Q265), H283 (= H266), N297 (= N280), I298 (≠ K281), L316 (≠ I299)
1efpA Electron transfer flavoprotein (etf) from paracoccus denitrificans (see paper)
46% identity, 39% coverage: 190:310/312 of query aligns to 188:307/307 of 1efpA
- binding flavin-adenine dinucleotide: G199 (= G201), R200 (= R202), G201 (= G203), S225 (= S227), R226 (= R228), A227 (≠ P229), Q239 (≠ Y242), V240 (≠ I243), G241 (= G244), T243 (≠ S246), G256 (= G259), I257 (= I260), S258 (= S261), A260 (≠ Q263), Q262 (= Q265), H263 (= H266), N277 (= N280), K278 (= K281), D295 (= D298), L296 (≠ I299)
P53571 Electron transfer flavoprotein subunit alpha; Alpha-ETF; Electron transfer flavoprotein large subunit; ETFLS from Methylophilus methylotrophus (Bacterium W3A1) (see 2 papers)
26% identity, 94% coverage: 19:311/312 of query aligns to 21:320/321 of P53571
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3clrD Crystal structure of the r236a etf mutant from m. Methylotrophus (see paper)
26% identity, 94% coverage: 19:311/312 of query aligns to 20:319/319 of 3clrD
- binding flavin-adenine dinucleotide: G209 (= G201), R210 (= R202), G211 (= G203), S235 (= S227), A236 (≠ R228), P237 (= P229), Q249 (≠ Y242), V250 (≠ I243), G251 (= G244), Q252 (≠ V245), S253 (= S246), G267 (= G259), I268 (= I260), S269 (= S261), S271 (≠ Q263), Q273 (= Q265), H274 (= H266), N288 (= N280), T289 (≠ K281), D306 (= D298), I307 (= I299)
Query Sequence
>15817 FitnessBrowser__Keio:15817
MSQLNSVWVFSDNPERYAELFGGAQQWGQQVYAIVQNTDQAQAVMPYGPKCLYVLAQNDA
LQRTENYAESIAALLKDKHPAMLLLAATKRGKALAARLSVQLNAALVNDATAVDIVDGHI
CAEHRMYGGLAFAQEKINSPLAIITLAPGVQEPCTSDTSHQCPTETVPYVAPRHEILCRE
RRAKAASSVDLSKAKRVVGVGRGLAAQDDLKMVHELAAVLNAEVGCSRPIAEGENWMERE
RYIGVSGVLLKSDLYLTLGISGQIQHMVGGNGAKVIVAINKDKNAPIFNYADYGLVGDIY
KVVPALISQLSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory