Comparing 15841 FitnessBrowser__Keio:15841 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3uqdB Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
100% identity, 100% coverage: 1:309/309 of query aligns to 1:309/309 of 3uqdB
3uqdA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with substrates and products (see paper)
100% identity, 100% coverage: 1:309/309 of query aligns to 1:309/309 of 3uqdA
3n1cA Crystal structure of the phosphofructokinase-2 from escherichia coli in complex with fructose-6-phosphate (see paper)
100% identity, 100% coverage: 1:309/309 of query aligns to 1:309/309 of 3n1cA
P06999 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; 6-phosphofructokinase isozyme II; Phosphohexokinase 2; EC 2.7.1.11 from Escherichia coli (strain K12) (see 3 papers)
100% identity, 100% coverage: 1:309/309 of query aligns to 1:309/309 of P06999
3uqeA Crystal structure of the phosphofructokinase-2 mutant y23d from escherichia coli
99% identity, 100% coverage: 1:309/309 of query aligns to 1:307/307 of 3uqeA
3cqdA Structure of the tetrameric inhibited form of phosphofructokinase-2 from escherichia coli (see paper)
98% identity, 100% coverage: 1:309/309 of query aligns to 1:304/304 of 3cqdA
P9WID3 ATP-dependent 6-phosphofructokinase isozyme 2; ATP-PFK 2; Phosphofructokinase 2; Phosphofructokinase B; Phosphohexokinase 2; Tagatose-6-phosphate kinase; EC 2.7.1.11; EC 2.7.1.144 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 98% coverage: 3:304/309 of query aligns to 13:313/339 of P9WID3
2f02A Crystal structure of lacc from enterococcus faecalis in complex with atp
28% identity, 98% coverage: 4:307/309 of query aligns to 3:304/319 of 2f02A
3ie7A The crystal structure of phosphofructokinase (lin2199) from listeria innocua in complex with atp at 1.6a
27% identity, 92% coverage: 4:287/309 of query aligns to 3:281/309 of 3ie7A
Sites not aligning to the query:
3julA Crystal structure of listeria innocua d-tagatose-6-phosphate kinase bound with substrate
27% identity, 92% coverage: 4:287/309 of query aligns to 3:274/298 of 3julA
2jgvB Structure of staphylococcus aureus d-tagatose-6-phosphate kinase in complex with adp (see paper)
29% identity, 89% coverage: 4:277/309 of query aligns to 6:279/314 of 2jgvB
Sites not aligning to the query:
2jg1C Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
28% identity, 89% coverage: 4:277/309 of query aligns to 7:280/315 of 2jg1C
Sites not aligning to the query:
2jg1A Structure of staphylococcus aureus d-tagatose-6-phosphate kinase with cofactor and substrate (see paper)
28% identity, 89% coverage: 4:277/309 of query aligns to 10:283/318 of 2jg1A
Sites not aligning to the query:
2ajrA Crystal structure of possible 1-phosphofructokinase (ec 2.7.1.56) (tm0828) from thermotoga maritima at 2.46 a resolution
25% identity, 99% coverage: 4:308/309 of query aligns to 3:315/320 of 2ajrA
8cqxA Ribokinase from t.Sp mutant a92g
27% identity, 87% coverage: 36:303/309 of query aligns to 34:297/300 of 8cqxA
6znxC Ribokinase from thermus species
28% identity, 87% coverage: 36:303/309 of query aligns to 21:262/265 of 6znxC
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
25% identity, 61% coverage: 95:284/309 of query aligns to 100:287/313 of 6ilsB
Sites not aligning to the query:
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 61% coverage: 95:284/309 of query aligns to 166:353/379 of A1A6H3
Sites not aligning to the query:
3kzhA Crystal structure of a putative sugar kinase from clostridium perfringens
28% identity, 33% coverage: 178:280/309 of query aligns to 177:278/316 of 3kzhA
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
27% identity, 93% coverage: 22:307/309 of query aligns to 14:305/306 of 5eynA
Sites not aligning to the query:
>15841 FitnessBrowser__Keio:15841
MVRIYTLTLAPSLDSATITPQIYPEGKLRCTAPVFEPGGGGINVARAIAHLGGSATAIFP
AGGATGEHLVSLLADENVPVATVEAKDWTRQNLHVHVEASGEQYRFVMPGAALNEDEFRQ
LEEQVLEIESGAILVISGSLPPGVKLEKLTQLISAAQKQGIRCIVDSSGEALSAALAIGN
IELVKPNQKELSALVNRELTQPDDVRKAAQEIVNSGKAKRVVVSLGPQGALGVDSENCIQ
VVPPPVKSQSTVGAGDSMVGAMTLKLAENASLEEMVRFGVAAGSAATLNQGTRLCSHDDT
QKIYAYLSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory