Comparing 15854 b1736 N,N'-diacetylchitobiose-specific enzyme IIA component of PTS (NCBI) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
P69791 PTS system N,N'-diacetylchitobiose-specific EIIA component; EIIA-Chb; EIII-Chb; IIIcel; N,N'-diacetylchitobiose-specific phosphotransferase enzyme IIA component from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:116/116 of query aligns to 1:116/116 of P69791
P0A0D6 PTS system lactose-specific EIIA component; EIIA-Lac; EIII-Lac; Lactose-specific phosphotransferase enzyme IIA component from Staphylococcus aureus (see 2 papers)
34% identity, 85% coverage: 15:113/116 of query aligns to 4:102/103 of P0A0D6
P23532 PTS system lactose-specific EIIA component; EIIA-Lac; EIII-Lac; Lactose-specific phosphotransferase enzyme IIA component from Lactococcus lactis subsp. lactis (Streptococcus lactis) (see 2 papers)
35% identity, 85% coverage: 15:113/116 of query aligns to 4:102/105 of P23532
>15854 b1736 N,N'-diacetylchitobiose-specific enzyme IIA component of PTS (NCBI)
MMDLDNIPDTQTEAEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMA
LNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQDHLMTSMLARELITELIELHEKLKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory