Comparing 15891 FitnessBrowser__Keio:15891 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6ofuB X-ray crystal structure of the ydji aldolase from escherichia coli k12 (see paper)
95% identity, 100% coverage: 1:278/278 of query aligns to 1:264/264 of 6ofuB
3q94A The crystal structure of fructose 1,6-bisphosphate aldolase from bacillus anthracis str. 'Ames ancestor'
41% identity, 99% coverage: 2:277/278 of query aligns to 3:285/285 of 3q94A
P13243 Probable fructose-bisphosphate aldolase; FBP aldolase; FBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Bacillus subtilis (strain 168) (see paper)
41% identity, 96% coverage: 10:277/278 of query aligns to 11:285/285 of P13243
8q59A Crystal structure of metal-dependent class ii sulfofructose phosphate aldolase from yersinia aldovae in complex with sulfofructose phosphate (yasqia-zn-sfp) (see paper)
39% identity, 94% coverage: 17:277/278 of query aligns to 18:276/280 of 8q59A
8q5aA Crystal structure of metal-dependent class ii sulfofructosephosphate aldolase from hafnia paralvei hpsqia-zn in complex with dihydroxyacetone phosphate (dhap) (see paper)
40% identity, 95% coverage: 15:277/278 of query aligns to 15:276/276 of 8q5aA
1gvfB Structure of tagatose-1,6-bisphosphate aldolase (see paper)
38% identity, 97% coverage: 6:276/278 of query aligns to 6:274/275 of 1gvfB
P0AB74 D-tagatose-1,6-bisphosphate aldolase subunit KbaY; TBPA; TagBP aldolase; D-tagatose-bisphosphate aldolase class II; Ketose 1,6-bisphosphate aldolase class II; Tagatose-bisphosphate aldolase; EC 4.1.2.40 from Escherichia coli (strain K12) (see paper)
37% identity, 97% coverage: 6:276/278 of query aligns to 7:283/286 of P0AB74
1rv8B Class ii fructose-1,6-bisphosphate aldolase from thermus aquaticus in complex with cobalt (see paper)
39% identity, 96% coverage: 10:277/278 of query aligns to 10:305/305 of 1rv8B
4to8A Methicillin-resistant staphylococcus aureus class iib fructose 1,6- bisphosphate aldolase (see paper)
38% identity, 96% coverage: 11:278/278 of query aligns to 11:278/279 of 4to8A
A8B2U2 Fructose-bisphosphate aldolase; Glfba; glFBPA; Fructose-1,6-bisphosphate aldolase; EC 4.1.2.13 from Giardia intestinalis (strain ATCC 50803 / WB clone C6) (Giardia lamblia) (see 4 papers)
33% identity, 99% coverage: 2:277/278 of query aligns to 3:307/323 of A8B2U2
3gayA Structure of giardia fructose-1,6-biphosphate aldolase in complex with tagatose-1,6-biphosphate (see paper)
33% identity, 99% coverage: 2:277/278 of query aligns to 2:303/319 of 3gayA
3ohiA Structure of giardia fructose-1,6-biphosphate aldolase in complex with 3-hydroxy-2-pyridone (see paper)
33% identity, 99% coverage: 2:277/278 of query aligns to 2:303/319 of 3ohiA
3gb6A Structure of giardia fructose-1,6-biphosphate aldolase d83a mutant in complex with fructose-1,6-bisphosphate (see paper)
33% identity, 99% coverage: 2:277/278 of query aligns to 2:302/318 of 3gb6A
2isvB Structure of giardia fructose-1,6-biphosphate aldolase in complex with phosphoglycolohydroxamate (see paper)
33% identity, 99% coverage: 2:277/278 of query aligns to 2:292/307 of 2isvB
2isvA Structure of giardia fructose-1,6-biphosphate aldolase in complex with phosphoglycolohydroxamate (see paper)
32% identity, 99% coverage: 2:277/278 of query aligns to 2:283/298 of 2isvA
3c52A Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with phosphoglycolohydroxamic acid, a competitive inhibitor (see paper)
33% identity, 94% coverage: 17:276/278 of query aligns to 17:295/296 of 3c52A
5ucpA Class ii fructose-1,6-bisphosphate aldolase e142a variant of helicobacter pylori with fbp and cleavage products (see paper)
33% identity, 94% coverage: 17:276/278 of query aligns to 17:291/292 of 5ucpA
3n9rA Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(4-hydroxybutyl)-phosphoglycolohydroxamic acid, a competitive inhibitor (see paper)
33% identity, 94% coverage: 17:276/278 of query aligns to 17:296/297 of 3n9rA
3c56A Class ii fructose-1,6-bisphosphate aldolase from helicobacter pylori in complex with n-(3-hydroxypropyl)-glycolohydroxamic acid bisphosphate, a competitive inhibitor (see paper)
33% identity, 94% coverage: 17:276/278 of query aligns to 17:296/297 of 3c56A
5uckA Class ii fructose-1,6-bisphosphate aldolase of helicobacter pylori with cleavage products (see paper)
33% identity, 94% coverage: 17:276/278 of query aligns to 17:290/291 of 5uckA
>15891 FitnessBrowser__Keio:15891
MLADIRYWENDATNKHYAIAHFNVWNAEMLMGVIDAAEEAKSPVIISFGTGFVGNTSFED
FSHMMVSMAQKATVPVITHWDHGRSMEIIHNAWTHGMNSLMRDASAFDFEENIRLTKEAV
DFFHPLGIPVEAELGHVGNETVYEEALAGYHYTDPDQAAEFVERTGCDSLAVAIGNQHGV
YTSEPQLNFEVVKRVRDAVSVPLVLHGASGISDADIKTAISLGIAKINIHTELCQAAMVA
VKENQDQPFLHLEREVRKAVKERALEKIKLFGSDGKAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory