SitesBLAST
Comparing 15892 FitnessBrowser__Keio:15892 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
99% identity, 100% coverage: 1:347/347 of query aligns to 1:347/347 of 5vm2A
- active site: C39 (= C39), G40 (= G40), S41 (= S41), H44 (= H44), H65 (= H65), E66 (= E66), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), D113 (= D113), P153 (= P153), G157 (= G157), K340 (= K340)
- binding magnesium ion: H65 (= H65), E66 (= E66), E152 (= E152)
- binding zinc ion: C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109)
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
40% identity, 98% coverage: 3:343/347 of query aligns to 2:344/348 of 1e3jA
- active site: C38 (= C39), G39 (= G40), S40 (= S41), H43 (= H44), H63 (= H65), E64 (= E66), C93 (= C95), C96 (= C98), C99 (= C101), C107 (= C109), T111 (≠ D113), P150 (= P153), G154 (= G157), K341 (= K340)
- binding phosphate ion: A174 (= A177), A196 (≠ V199), R197 (≠ D200), S198 (≠ V201), R201 (= R205)
- binding zinc ion: C38 (= C39), H63 (= H65), E64 (= E66), C93 (= C95), C96 (= C98), C99 (= C101), C107 (= C109)
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
39% identity, 94% coverage: 3:329/347 of query aligns to 9:336/357 of Q00796
- C45 (= C39) binding
- H70 (= H65) binding
- E71 (= E66) binding
- R110 (≠ K105) to P: in HMNR8; results in protein aggregation
- H135 (= H131) to R: in HMNR8; results in protein aggregation
- A153 (= A149) to D: in HMNR8; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I180) binding
- D204 (= D200) binding
- R209 (= R205) binding
- Q239 (≠ T233) to L: in dbSNP:rs1042079
- N269 (≠ K263) to T: in dbSNP:rs930337
- VGL 273:275 (≠ VGT 267:269) binding
- VFR 297:299 (= VFR 290:292) binding
- V322 (= V315) to I: in HMNR8; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
39% identity, 94% coverage: 3:329/347 of query aligns to 8:335/356 of 1pl6A
- active site: C44 (= C39), G45 (= G40), S46 (= S41), H49 (= H44), H69 (= H65), E70 (= E66), R99 (≠ C95), D102 (≠ C98), C105 (= C101), S113 (≠ C109), F117 (≠ D113), P156 (= P153), G160 (= G157)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C39), S46 (= S41), I56 (vs. gap), F59 (= F51), H69 (= H65), E155 (= E152), L274 (≠ T269), F297 (= F291)
- binding nicotinamide-adenine-dinucleotide: G181 (= G178), P182 (≠ C179), I183 (= I180), D203 (= D200), L204 (≠ V201), R208 (= R205), C249 (≠ T244), T250 (≠ A245), V272 (= V267), G273 (= G268), L274 (≠ T269), F297 (= F291), R298 (= R292)
- binding zinc ion: C44 (= C39), H69 (= H65)
Sites not aligning to the query:
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
37% identity, 95% coverage: 2:331/347 of query aligns to 6:335/354 of P07846
- C43 (= C39) binding
- Y49 (≠ G45) binding
- H67 (= H65) binding
- E68 (= E66) binding
- E153 (= E152) binding
- R296 (= R292) binding
- Y297 (= Y293) binding
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
37% identity, 95% coverage: 2:331/347 of query aligns to 2:332/351 of 3qe3A
- active site: C39 (= C39), G40 (= G40), S41 (= S41), H44 (= H44), H64 (= H65), E65 (= E66), R94 (≠ C95), D97 (≠ C98), C100 (= C101), S108 (≠ C109), F112 (≠ D113), P151 (= P153), G155 (= G157)
- binding glycerol: Y45 (≠ G45), F54 (= F51), T116 (= T117), R293 (= R292)
- binding zinc ion: C39 (= C39), H64 (= H65), E65 (= E66)
Sites not aligning to the query:
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
38% identity, 95% coverage: 2:331/347 of query aligns to 8:338/357 of P27867
Q96V44 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Hypocrea jecorina (Trichoderma reesei) (see paper)
35% identity, 93% coverage: 25:347/347 of query aligns to 52:377/377 of Q96V44
- DI 224:225 (≠ DV 200:201) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-362.
- A362 (≠ V332) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 224-SR-225.
3m6iA L-arabinitol 4-dehydrogenase (see paper)
36% identity, 91% coverage: 25:340/347 of query aligns to 35:352/358 of 3m6iA
- active site: C49 (= C39), G50 (= G40), S51 (= S41), H54 (= H44), H74 (= H65), E75 (= E66), C104 (= C95), C107 (= C98), C110 (= C101), C118 (= C109), D122 (= D113), P160 (= P153), A164 (≠ G157), K352 (= K340)
- binding nicotinamide-adenine-dinucleotide: C49 (= C39), V163 (= V156), G185 (= G178), P186 (≠ C179), I187 (= I180), D207 (= D200), R212 (= R205), C255 (≠ T244), T256 (≠ A245), I278 (≠ V267), G279 (= G268), V280 (≠ T269), R304 (= R292)
- binding zinc ion: C49 (= C39), H74 (= H65), C104 (= C95), C107 (= C98), C110 (= C101), C118 (= C109)
Q7SI09 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 2 papers)
36% identity, 91% coverage: 25:340/347 of query aligns to 39:356/363 of Q7SI09
- C53 (= C39) binding
- F59 (≠ G45) mutation F->A,S,Y: No effect.
- H78 (= H65) binding
- E79 (= E66) binding
- C108 (= C95) binding
- C111 (= C98) binding
- C114 (= C101) binding
- C122 (= C109) binding
- E163 (= E152) binding
- PI 190:191 (≠ CI 179:180) binding
- D211 (= D200) binding
- DI 211:212 (≠ DV 200:201) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-348.
- R216 (= R205) binding
- I282 (≠ V267) binding
- QYR 306:308 (≠ VFR 290:292) binding
- S348 (≠ V332) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 211-SR-212.
A2QAC0 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) (see 2 papers)
35% identity, 90% coverage: 28:340/347 of query aligns to 44:367/386 of A2QAC0
- M70 (≠ P54) mutation to F: Abolishes enzyme activity.
- DI 213:214 (≠ DV 200:201) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-359.
- Y318 (≠ F291) mutation to F: Increases affinity for D-sorbitol.
- A359 (≠ V332) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 213-SR-214.
B6HI95 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) (Penicillium chrysogenum) (see paper)
36% identity, 91% coverage: 25:340/347 of query aligns to 40:366/385 of B6HI95
- DI 212:213 (≠ DV 200:201) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-358.
- S358 (≠ V332) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 212-SR-213.
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
36% identity, 87% coverage: 28:329/347 of query aligns to 29:341/357 of 7y9pA
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
29% identity, 94% coverage: 5:329/347 of query aligns to 2:326/341 of P07913
- C38 (= C39) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
30% identity, 89% coverage: 8:317/347 of query aligns to 9:316/343 of 4ej6A
- active site: C40 (= C39), G41 (= G40), T42 (≠ S41), H45 (= H44), H61 (= H65), E62 (= E66), C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109), R109 (≠ D113), P147 (= P153), C151 (≠ G157)
- binding zinc ion: C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109)
Sites not aligning to the query:
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
30% identity, 89% coverage: 8:317/347 of query aligns to 9:316/342 of 4ejmA
- active site: C40 (= C39), G41 (= G40), T42 (≠ S41), H45 (= H44), H61 (= H65), E62 (= E66), C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109), R109 (≠ D113), P147 (= P153), C151 (≠ G157)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G176), G172 (= G178), V173 (≠ C179), I174 (= I180), T194 (≠ D200), R195 (≠ V201), Q196 (≠ L202), K199 (≠ R205), C240 (≠ T244), E245 (≠ V249), T246 (= T250), L263 (≠ V267), V265 (≠ T269), I291 (≠ R292)
- binding zinc ion: C91 (= C95), C94 (= C98), C97 (= C101), C105 (= C109)
Sites not aligning to the query:
4uejA Closed state of galactitol-1-phosphate 5-dehydrogenase from e. Coli in complex with glycerol. (see paper)
30% identity, 93% coverage: 12:334/347 of query aligns to 10:336/346 of 4uejA
- active site: C38 (= C39), G39 (= G40), S40 (= S41), P43 (vs. gap), H59 (= H65), E60 (= E66), C89 (= C95), C92 (= C98), C95 (= C101), C103 (= C109), D107 (= D113), P145 (= P153), G149 (= G157)
- binding glycerol: H59 (= H65), E144 (= E152)
- binding zinc ion: C89 (= C95), C92 (= C98), C95 (= C101), C103 (= C109)
Sites not aligning to the query:
4a2cA Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli (see paper)
30% identity, 93% coverage: 12:334/347 of query aligns to 10:336/346 of 4a2cA
- active site: C38 (= C39), G39 (= G40), S40 (= S41), P43 (vs. gap), H59 (= H65), E60 (= E66), C89 (= C95), C92 (= C98), C95 (= C101), C103 (= C109), D107 (= D113), P145 (= P153), G149 (= G157)
- binding zinc ion: C89 (= C95), C92 (= C98), C95 (= C101), C103 (= C109)
Sites not aligning to the query:
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
28% identity, 91% coverage: 15:329/347 of query aligns to 18:333/348 of O58389
- C42 (= C39) binding
- T44 (≠ S41) mutation to A: Total loss of enzymatic activity.
- H67 (= H65) binding
- E68 (= E66) binding
- C97 (= C95) binding
- C100 (= C98) binding
- C103 (= C101) binding
- C111 (= C109) binding
- E152 (= E152) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I180) binding
- E199 (≠ D200) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R205) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VGT 267:269) binding
- IT 291:292 (≠ V- 290) binding
- R294 (vs. gap) mutation to A: 4000-fold decrease in catalytic efficiency.
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
28% identity, 91% coverage: 15:329/347 of query aligns to 16:331/347 of 3gfbA
- active site: C40 (= C39), G41 (= G40), T42 (≠ S41), H45 (= H44), H65 (= H65), E66 (= E66), C95 (= C95), C98 (= C98), C101 (= C101), C109 (= C109), K113 (≠ D113), P151 (= P153), A155 (≠ G157)
- binding nicotinamide-adenine-dinucleotide: G173 (= G176), G175 (= G178), P176 (≠ C179), L177 (≠ I180), S196 (≠ V199), E197 (≠ D200), P198 (≠ V201), R202 (= R205), F241 (≠ T244), S242 (≠ A245), A244 (≠ S247), L264 (≠ V267), G265 (= G268), L266 (≠ T269), I289 (≠ V290), T290 (vs. gap)
Sites not aligning to the query:
Query Sequence
>15892 FitnessBrowser__Keio:15892
MKNSKAILQVPGTMKIISAEIPVPKEDEVLIKVEYVGICGSDVHGFESGPFIPPKDPNQE
IGLGHECAGTVVAVGSRVRKFKPGDRVNIEPGVPCGHCRYCLEGKYNICPDVDFMATQPN
YRGALTHYLCHPESFTYKLPDNMDTMEGALVEPAAVGMHAAMLADVKPGKKIIILGAGCI
GLMTLQACKCLGATEIAVVDVLEKRLAMAEQLGATVVINGAKEDTIARCQQFTEDMGADI
VFETAGSAVTVKQAPYLVMRGGKIMIVGTVPGDSAINFLKINREVTIQTVFRYANRYPVT
IEAISSGRFDVKSMVTHIYDYRDVQQAFEESVNNKRDIIKGVIKISD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory