Comparing 15935 FitnessBrowser__Keio:15935 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P69797 PTS system mannose-specific EIIAB component; EIIAB-Man; EIII-Man; EC 2.7.1.191 from Escherichia coli (strain K12) (see 4 papers)
100% identity, 100% coverage: 1:323/323 of query aligns to 1:323/323 of P69797
1vrcB Complex of enzyme iiamannose and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
100% identity, 40% coverage: 2:130/323 of query aligns to 1:129/129 of 1vrcB
P26380 PTS system fructose-specific EIIB component; EIIB-Fru; Fructose-specific phosphotransferase enzyme IIB component; lev-PTS; p18; EC 2.7.1.202 from Bacillus subtilis (strain 168) (see paper)
48% identity, 50% coverage: 162:323/323 of query aligns to 2:163/163 of P26380
P26379 PTS system fructose-specific EIIA component; EIIA-Fru; Fructose-specific phosphotransferase enzyme IIA component; lev-PTS; p16 from Bacillus subtilis (strain 168) (see paper)
38% identity, 32% coverage: 3:106/323 of query aligns to 2:105/146 of P26379
>15935 FitnessBrowser__Keio:15935
MTIAIVIGTHGWAAEQLLKTAEMLLGEQENVGWIDFVPGENAETLIEKYNAQLAKLDTTK
GVLFLVDTWGGSPFNAASRIVVDKEHYEVIAGVNIPMLVETLMARDDDPSFDELVALAVE
TGREGVKALKAKPVEKAAPAPAAAAPKAAPTPAKPMGPNDYMVIGLARIDDRLIHGQVAT
RWTKETNVSRIIVVSDEVAADTVRKTLLTQVAPPGVTAHVVDVAKMIRVYNNPKYAGERV
MLLFTNPTDVERLVEGGVKITSVNVGGMAFRQGKTQVNNAVSVDEKDIEAFKKLNARGIE
LEVRKVSTDPKLKMMDLISKIDK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory