SitesBLAST
Comparing 16034 FitnessBrowser__Keio:16034 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
48% identity, 83% coverage: 40:261/266 of query aligns to 3:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
47% identity, 83% coverage: 40:261/266 of query aligns to 3:226/226 of 4zv1A
- binding arginine: E11 (= E48), F14 (≠ Y51), F52 (≠ W89), A69 (≠ N106), G70 (≠ Q107), M71 (≠ V108), T72 (= T109), R77 (= R114), Q117 (≠ G155), S120 (≠ T158), T121 (≠ N159), D161 (= D197)
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
40% identity, 85% coverage: 34:260/266 of query aligns to 3:228/229 of 5t0wA
- binding arginine: D17 (≠ E48), Y20 (= Y51), W58 (= W89), S75 (≠ N106), G76 (≠ Q107), M77 (≠ V108), T78 (= T109), R83 (= R114), Q126 (≠ G155), T129 (= T158), T130 (≠ N159), D168 (= D197)
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
39% identity, 91% coverage: 23:264/266 of query aligns to 1:234/237 of 3vv5A
- binding l-thialysine: E20 (= E48), F23 (≠ Y51), N27 (≠ S55), F61 (≠ W89), A78 (≠ N106), S79 (≠ Q107), G81 (≠ T109), R86 (= R114), T127 (= T158), T128 (≠ N159), Y129 (= Y160)
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
39% identity, 91% coverage: 23:264/266 of query aligns to 5:238/241 of 3vvfA
- binding arginine: E24 (= E48), F27 (≠ Y51), F65 (≠ W89), A82 (≠ N106), S83 (≠ Q107), H84 (≠ V108), G85 (≠ T109), R90 (= R114), Q128 (≠ G155), T131 (= T158), T132 (≠ N159), Y133 (= Y160), E196 (≠ Q222)
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
39% identity, 91% coverage: 23:264/266 of query aligns to 5:238/241 of 3vveA
- binding lysine: E24 (= E48), F27 (≠ Y51), F65 (≠ W89), S83 (≠ Q107), H84 (≠ V108), R90 (= R114), Q128 (≠ G155), T131 (= T158), T132 (≠ N159), Y133 (= Y160), E196 (≠ Q222)
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
39% identity, 91% coverage: 23:264/266 of query aligns to 5:238/241 of 3vvdA
- binding L-ornithine: E24 (= E48), F65 (≠ W89), S83 (≠ Q107), H84 (≠ V108), G85 (≠ T109), R90 (= R114), Q128 (≠ G155), T131 (= T158), T132 (≠ N159), Y133 (= Y160), E196 (≠ Q222)
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
37% identity, 86% coverage: 34:261/266 of query aligns to 3:228/229 of 6svfA
- binding arginine: F20 (≠ Y51), F58 (≠ W89), S75 (≠ N106), G76 (≠ Q107), M77 (≠ V108), T78 (= T109), R83 (= R114), Q124 (≠ G155), T127 (= T158), T128 (≠ N159), D165 (= D197)
2ylnA Crystal structure of the l-cystine solute receptor of neisseria gonorrhoeae in the closed conformation (see paper)
38% identity, 88% coverage: 33:265/266 of query aligns to 6:238/240 of 2ylnA
- binding cysteine: E21 (= E48), Y24 (= Y51), W62 (= W89), W62 (= W89), N79 (= N106), R88 (= R114), S127 (≠ G155), S130 (≠ T158), N131 (= N159), G148 (≠ D178), L149 (≠ D179), N166 (≠ V196)
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
32% identity, 83% coverage: 40:260/266 of query aligns to 3:226/234 of 3k4uE
- binding lysine: E11 (= E48), Y14 (= Y51), W52 (= W89), G70 (≠ Q107), T72 (= T109), R77 (= R114), K120 (≠ G155), V123 (≠ T158), S124 (≠ N159), E144 (≠ D179), D162 (= D197)
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
34% identity, 83% coverage: 43:263/266 of query aligns to 5:224/226 of 8eyzA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
36% identity, 81% coverage: 45:259/266 of query aligns to 18:233/235 of 4g4pA
- binding glutamine: F24 (≠ Y51), F62 (≠ W89), A79 (≠ N106), G80 (≠ Q107), M81 (≠ V108), S82 (≠ T109), R87 (= R114), K127 (≠ G155), T130 (= T158), E131 (≠ N159), D171 (≠ R198)
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
33% identity, 86% coverage: 37:266/266 of query aligns to 4:237/237 of 4i62A
- binding arginine: N15 (≠ E48), F18 (≠ Y51), F59 (≠ W89), S76 (≠ N106), G77 (≠ Q107), V78 (= V108), S79 (≠ T109), R84 (= R114), Q125 (≠ G155), S128 (≠ T158), I129 (≠ N159), Q130 (≠ Y160), E167 (≠ D197)
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
34% identity, 83% coverage: 41:260/266 of query aligns to 1:222/224 of 4ymxA
- binding arginine: S8 (≠ E48), D10 (≠ T50), F11 (≠ Y51), F52 (≠ W89), A69 (≠ N106), G70 (≠ Q107), M71 (≠ V108), T72 (= T109), R77 (= R114), Q116 (≠ G155), T119 (= T158), T120 (≠ N159), E157 (≠ D197)
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
29% identity, 94% coverage: 14:264/266 of query aligns to 5:257/260 of P02911
- D33 (≠ E48) binding ; binding ; binding ; mutation to A: Decreases arginine and histidine binding affinity.
- Y36 (= Y51) mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
- D52 (≠ E67) mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
- C60 (≠ A75) modified: Disulfide link with 67
- C67 (≠ A82) modified: Disulfide link with 60
- F74 (≠ W89) mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
- S91 (≠ N106) binding ; binding ; mutation to A: Has no effect on the arginine and histidine binding affinity.
- S92 (≠ Q107) binding ; binding ; binding ; mutation to A: Decreases arginine and histidine binding affinity.
- S94 (≠ T109) binding ; binding ; binding ; mutation to A: Decreases arginine and histidine binding affinity.
- R99 (= R114) binding ; binding ; binding ; mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
- L139 (≠ G155) mutation to K: Changes ligand specificity. Can bind glutamine. Still able to bind basic amino acids, however, with 1000-fold less affinity for arginine.; mutation to Q: Does not affect ligand preference.
- T143 (≠ N159) binding ; binding ; binding
- D183 (= D197) binding ; binding ; mutation to A: Shows a drastic decrease in arginine and histidine binding affinity.
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
30% identity, 84% coverage: 42:264/266 of query aligns to 27:257/260 of P0AEU0
- C60 (≠ A75) modified: Disulfide link with 67
- C67 (≠ A82) modified: Disulfide link with 60
- S91 (≠ N106) binding
- S92 (≠ Q107) binding
- S94 (≠ T109) binding
- R99 (= R114) binding
- T143 (≠ N159) binding
- D183 (= D197) binding
Sites not aligning to the query:
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
31% identity, 84% coverage: 42:264/266 of query aligns to 2:232/235 of 5owfA
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
31% identity, 82% coverage: 42:260/266 of query aligns to 7:227/228 of 2y7iA
- binding arginine: Y16 (= Y51), E20 (≠ S55), F54 (≠ W89), A71 (≠ N106), G72 (≠ Q107), D74 (≠ T109), R79 (= R114), E118 (≠ G155), T121 (= T158), T122 (≠ N159), D160 (= D197)
- binding zinc ion: H9 (≠ L44), D23 (≠ G58), D25 (= D60), D55 (= D90), D67 (= D102), D140 (= D177)
P02910 Histidine-binding periplasmic protein; HBP from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
30% identity, 83% coverage: 43:264/266 of query aligns to 28:257/260 of P02910
- E40 (≠ S55) mutation to K: Decrease in ATPase-inducing activity and histidine transport; when associated with K-47.
- K42 (≠ Q57) mutation to E: Increases ATPase-inducing activity and histidine transport; when associated with K-47.
- E47 (≠ K62) mutation to K: Decrease in ATPase-inducing activity and histidine transport; when associated with K-40. Increases ATPase-inducing activity and histidine transport; when associated with E-42.
- D171 (= D185) mutation D->A,N: Strong decrease in ATPase-inducing activity and histidine transport.
- R176 (= R190) mutation R->D,S: Strong decrease in ATPase-inducing activity and histidine transport.
- D178 (= D192) mutation to A: Slight decrease in ATPase-inducing activity and histidine transport.
Sites not aligning to the query:
1hslA Refined 1.89 angstroms structure of the histidine-binding protein complexed with histidine and its relationship with many other active transport(slash)chemosensory receptors (see paper)
30% identity, 83% coverage: 43:264/266 of query aligns to 6:235/238 of 1hslA
Query Sequence
>16034 FitnessBrowser__Keio:16034
MKLAHLGRQALMGVMAVALVAGMSVKSFADEGLLNKVKERGTLLVGLEGTYPPFSFQGDD
GKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDF
STPYTISGIQALVKKGNEGTIKTADDLKGKKVGVGLGTNYEEWLRQNVQGVDVRTYDDDP
TKYQDLRVGRIDAILVDRLAALDLVKKTNDTLAVTGEAFSRQESGVALRKGNEDLLKAVN
DAIAEMQKDGTLQALSEKWFGADVTK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory