SitesBLAST – Find functional sites

 

SitesBLAST

Comparing 16092 FitnessBrowser__Keio:16092 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 7 hits to proteins with known functional sites (download)

Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
23% identity, 65% coverage: 32:317/438 of query aligns to 52:318/444 of Q8NLB7

query
sites
Q8NLB7
V
 
I
V
 
F
D
|
D
W
 
G
Y
 
Y
D
|
D
F
 
L
L
 
I
L
 
V
Y
 
Y
G
 
G
I
 
-
T
 
T
A
 
V
A
 
Q
L
 
S
V
 
A
F
 
L
N
 
A
R
 
K
E
 
E
F
 
W
F
 
N
P
 
L
Q
 
S
V
 
-
S
 
S
P
 
A
A
 
T
M
 
L
G
 
G
T
 
T
L
 
I
A
 
G
A
 
S
F
 
T
A
 
A
T
 
F
F
 
F
G
 
G
V
 
M
G
 
A
F
 
-
L
 
-
F
 
-
R
 
-
P
 
-
L
 
I
G
 
G
G
 
A
V
 
V
I
 
F
F
 
I
G
 
G
H
 
R
F
 
L
G
 
S
D
 
D
R
|
R
L
 
V
G
 
G
R
 
R
K
 
K
R
 
A
M
 
A
L
 
V
M
 
I
L
 
G
T
 
S
V
 
V
W
 
L
M
 
I
M
 
L
G
 
S
I
 
V
A
 
F
T
 
T
A
 
M
L
 
L
I
 
C
G
 
A
I
 
F
L
 
A
P
 
P
S
 
N
F
 
-
S
 
-
T
 
-
I
 
-
G
 
-
W
 
-
W
 
-
A
 
-
P
 
P
I
 
W
L
 
V
L
 
F
V
 
G
T
 
A
L
 
F
R
 
R
A
 
F
I
 
I
Q
 
A
G
 
G
F
 
L
A
 
G
V
 
L
G
 
G
G
 
G
E
 
L
W
 
V
G
 
P
G
 
S
A
 
V
A
 
N
L
 
A
L
 
M
S
 
T
V
 
S
E
 
D
S
 
L
A
 
V
P
 
P
K
 
R
N
 
K
K
 
T
K
 
M
A
 
S
F
 
A
Y
 
W
S
 
A
-
 
T
-
 
V
-
 
M
-
 
M
S
 
S
G
 
G
V
 
V
Q
 
P
V
 
I
G
 
G
Y
 
G
G
 
S
V
 
I
G
 
A
L
 
A
L
 
V
L
 
L
S
 
-
T
 
-
G
 
-
L
 
-
V
 
-
S
 
A
L
 
L
I
 
V
S
 
V
M
 
V
M
 
P
T
 
S
T
 
S
D
 
E
E
 
E
Q
 
-
F
 
-
L
 
-
S
 
-
W
 
W
G
 
G
W
 
W
R
 
R
I
 
F
P
 
M
F
 
F
L
 
L
F
 
I
S
 
A
I
 
L
V
 
I
L
 
P
V
 
L
L
 
V
G
 
V
A
 
G
L
 
L
W
 
P
V
 
I
R
 
A
N
 
M
G
 
K
M
 
V
E
 
I
E
 
P
S
 
S
A
 
D
E
 
K
F
 
A
E
 
I
Q
 
K
Q
 
A
Q
 
D
H
 
H
Y
 
D
Q
 
-
A
 
-
A
 
-
A
 
-
K
 
-
K
 
-
R
 
-
I
 
-
P
 
-
V
 
-
I
 
I
E
 
R
A
 
E
L
 
G
L
 
H
R
 
D
H
 
E
P
 
P
G
 
A
A
 
G
F
 
F
L
 
K
K
 
D
I
 
L
I
 
L
A
 
V
L
 
D
R
 
R
L
 
Y
C
 
R
E
 
W
L
 
I
L
 
S
T
 
I
M
 
W
Y
 
F
I
 
A
V
 
L
T
 
A
A
 
T
F
 
F
A
 
V
L
 
T
N
 
L
Y
 
L
S
 
A
T
 
W
Q
 
Y
N
 
G
M
 
L
G
 
G
-
 
T
-
 
W
L
 
L
P
 
P
R
 
R
-
 
L
-
 
M
-
 
E
-
 
T
-
 
A
-
 
G
-
 
Y
-
 
E
-
 
F
-
 
G
-
 
H
-
 
A
-
 
L
-
 
M
-
 
F
E
 
T
L
 
L
F
 
A
L
 
L
N
 
N
I
 
L
G
 
G
L
 
A
L
 
V
V
 
I
G
 
G
G
 
-
L
 
-
S
 
S
C
 
V
L
 
V
T
 
T
I
 
-
P
 
-
C
 
-
F
 
-
A
 
A
W
|
W
L
 
A
A
 
G
D
|
D
R
|
R
F
 
F
G
 
G
R
 
P
R
x
I
R
 
R

Sites not aligning to the query:

Q9R0W2 Solute carrier family 22 member 2; Organic cation transporter 2; rOCT2 from Rattus norvegicus (Rat) (see paper)
24% identity, 42% coverage: 68:249/438 of query aligns to 154:342/555 of Q9R0W2

query
sites
Q9R0W2
A
 
S
T
 
V
F
 
V
G
 
N
V
 
V
G
 
G
F
 
F
L
 
F
F
 
-
R
 
-
P
 
-
L
 
I
G
 
G
G
 
A
V
 
M
I
 
M
F
 
I
G
 
G
H
 
Y
F
 
L
G
 
A
D
 
D
R
 
R
L
 
F
G
 
G
R
 
R
K
 
K
R
 
F
M
 
C
L
 
L
M
 
L
L
 
V
T
 
T
V
 
I
W
 
L
M
 
I
M
 
N
G
 
A
I
 
I
A
 
S
T
 
G
A
 
A
L
 
L
I
 
M
G
 
A
I
 
I
L
 
S
P
 
P
S
 
N
F
 
Y
S
 
A
T
 
-
I
 
-
G
 
-
W
 
W
W
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
M
V
 
L
T
 
V
L
 
F
R
 
R
A
 
F
I
 
L
Q
 
Q
G
 
G
F
 
L
A
 
V
V
 
S
G
 
K
G
 
A
E
 
G
W
 
W
G
 
L
G
 
I
A
 
G
A
 
Y
L
 
I
L
 
L
S
 
I
V
 
T
E
 
E
S
 
F
A
 
V
P
 
G
K
 
L
N
 
G
K
 
Y
K
 
R
A
 
R
F
 
M
Y
 
V
S
 
G
S
 
I
G
 
C
V
 
Y
Q
 
Q
V
 
I
G
 
A
Y
 
F
G
 
T
V
 
V
G
 
G
L
 
L
L
 
L
L
 
I
S
 
L
T
 
A
G
 
G
L
 
V
V
 
A
S
 
Y
L
 
V
I
 
I
-
 
P
-
 
N
-
 
W
-
 
R
-
 
W
-
 
L
-
 
Q
-
 
F
S
 
A
M
 
V
M
 
T
T
 
L
T
 
P
D
 
N
E
 
F
Q
 
C
F
 
F
L
 
L
S
 
L
W
 
Y
G
 
F
W
 
W
R
 
C
I
 
I
P
 
P
-
 
E
-
 
S
-
 
P
-
 
R
F
 
W
L
 
L
F
 
I
S
 
S
I
 
Q
V
 
N
L
 
K
V
 
I
L
 
V
G
 
K
A
 
A
L
 
M
W
 
K
V
 
I
-
 
I
-
 
K
-
 
H
-
 
I
-
 
A
-
 
K
R
 
K
N
 
N
G
 
G
M
 
K
E
 
S
E
 
V
S
 
P
A
 
V
E
 
S
F
 
L
E
 
Q
Q
 
N
Q
 
L
Q
 
T
H
 
P
Y
 
D
Q
 
E
A
 
D
A
 
A
A
 
G
K
 
K
K
 
K
R
 
L
I
 
N
P
 
P
V
 
S
I
 
F
E
 
L
A
 
D
L
 
L
L
 
V
R
 
R
H
 
T
P
 
P

Sites not aligning to the query:

8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
22% identity, 45% coverage: 79:273/438 of query aligns to 129:324/497 of 8bw7A

query
sites
8bw7A
L
 
L
G
 
G
G
 
A
V
 
M
I
 
V
F
 
F
G
 
G
H
 
Y
F
 
L
G
 
A
D
 
D
R
 
R
L
 
L
G
 
G
R
 
R
K
 
R
R
 
K
M
 
V
L
 
L
M
 
I
L
 
L
T
 
N
V
 
Y
W
 
L
M
 
Q
M
 
T
G
 
A
I
 
V
A
 
S
T
 
G
A
 
T
L
 
C
I
 
A
G
 
A
I
 
Y
L
 
A
P
 
P
S
 
N
F
 
Y
S
 
T
T
 
-
I
 
-
G
 
-
W
 
-
W
 
-
A
 
-
P
 
-
I
 
-
L
 
V
L
 
Y
V
 
C
T
 
V
L
 
F
R
 
R
A
 
L
I
 
L
Q
 
S
G
 
G
F
 
M
A
 
S
V
 
L
G
 
A
G
 
S
E
 
I
W
 
A
G
 
I
G
 
N
A
 
C
A
 
M
L
 
T
L
 
L
S
 
N
V
 
V
E
 
E
S
 
W
A
 
M
P
 
P
K
 
I
N
 
H
K
 
T
K
 
R
A
 
A
F
 
Y
Y
 
V
S
 
G
S
 
T
G
 
L
V
 
I
Q
x
G
V
 
Y
G
 
V
Y
|
Y
G
 
S
V
 
L
G
 
G
L
 
Q
L
 
F
L
 
L
S
 
L
T
 
A
G
 
G
L
 
I
V
 
A
S
 
Y
L
 
A
I
 
V
S
 
P
M
 
H
M
 
W
T
 
R
T
 
H
D
 
L
E
 
Q
Q
 
L
F
 
V
L
 
V
S
 
S
W
 
V
G
 
P
W
 
F
R
 
F
I
 
I
P
 
A
F
 
F
L
 
I
F
 
Y
S
 
S
I
 
W
V
 
F
L
 
F
V
 
I
L
 
E
G
 
S
A
 
A
L
 
R
W
 
W
V
 
Y
R
 
S
N
 
S
-
 
S
-
 
G
-
 
R
-
 
L
-
 
D
-
 
L
-
 
T
-
 
L
-
 
R
G
 
A
M
 
L
E
 
Q
E
 
R
S
 
V
A
 
A
E
 
R
F
 
I
E
 
N
Q
 
G
Q
 
K
Q
 
Q
H
 
-
Y
 
-
Q
 
E
A
 
E
A
 
G
A
 
A
K
 
K
K
 
L
R
 
S
I
 
I
P
 
E
V
 
V
I
 
L
E
 
R
A
 
T
L
 
S
L
 
L
R
 
Q
H
 
S
P
 
A
G
 
M
A
 
E
F
 
L
L
 
L
K
 
R
I
 
C
I
 
P
A
 
T
L
 
L
R
 
R
-
 
H
-
 
L
-
 
F
L
 
L
C
 
C
E
 
-
L
 
L
L
 
S
T
 
M
M
 
L
Y
 
W
I
 
F
V
 
A
T
 
T
A
 
S
F
 
F
A
 
A

Sites not aligning to the query:

8jttA Hoct1 in complex with metformin in outward occluded conformation (see paper)
24% identity, 42% coverage: 68:249/438 of query aligns to 75:263/454 of 8jttA

query
sites
8jttA
A
 
S
T
 
C
F
 
L
G
 
N
V
 
A
G
 
G
F
 
F
L
 
L
F
 
F
R
 
G
P
 
S
L
 
L
G
 
G
G
 
-
V
 
-
I
 
-
F
 
V
G
 
G
H
 
Y
F
 
F
G
 
A
D
 
D
R
 
R
L
 
F
G
 
G
R
 
R
K
 
K
R
 
L
M
 
C
L
 
L
M
 
L
L
 
G
T
 
T
V
 
V
W
 
L
M
 
V
M
 
N
G
 
A
I
 
V
A
 
S
T
 
G
A
 
V
L
 
L
I
 
M
G
 
A
I
 
F
L
 
S
P
 
P
S
 
N
F
 
Y
S
 
M
T
 
S
I
 
-
G
 
-
W
 
-
W
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
M
V
 
L
T
 
L
L
 
F
R
 
R
A
 
L
I
 
L
Q
 
Q
G
 
G
F
 
L
A
 
V
V
 
S
G
 
K
G
 
G
E
 
N
W
 
W
G
 
M
G
 
A
A
 
G
A
 
Y
L
 
T
L
 
L
S
 
I
V
 
T
E
 
E
S
 
F
A
 
V
P
 
G
K
 
S
N
 
G
K
 
S
K
 
R
A
 
R
F
 
T
Y
 
V
S
 
A
S
 
I
G
 
M
V
 
Y
Q
 
Q
V
 
M
G
 
A
Y
 
F
G
 
T
V
 
V
G
 
G
L
 
L
L
 
V
L
 
A
S
 
L
T
 
T
G
 
G
L
 
L
-
 
A
-
 
Y
-
 
A
-
 
L
-
 
P
-
 
H
-
 
W
-
 
R
-
 
W
-
 
L
-
 
Q
-
 
L
-
 
A
V
 
V
S
 
S
L
 
L
I
 
P
S
 
T
M
 
F
M
 
L
T
 
-
T
 
-
D
 
-
E
 
-
Q
 
-
F
 
F
L
 
L
S
 
L
W
 
Y
G
 
Y
W
 
W
R
 
C
I
 
V
P
 
P
-
 
E
-
 
S
-
 
P
-
 
R
F
 
W
L
 
L
F
 
L
S
 
S
-
 
Q
-
 
K
-
 
R
-
 
N
-
 
T
-
 
E
I
 
A
V
 
I
L
 
K
V
 
I
L
 
M
G
 
D
A
 
H
L
 
I
W
 
A
V
 
Q
R
 
K
N
 
N
G
 
G
M
 
K
E
 
L
E
 
P
S
 
P
A
 
A
E
 
D
F
 
L
E
 
K
Q
 
M
Q
 
L
Q
 
S
H
 
L
Y
 
E
Q
 
E
A
 
D
A
 
V
A
 
T
K
 
E
K
 
K
R
 
L
I
 
S
P
 
P
V
 
S
I
 
F
E
 
A
A
 
D
L
 
L
L
 
F
R
 
R
H
 
T
P
 
P

Sites not aligning to the query:

P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 32% coverage: 69:208/438 of query aligns to 178:305/616 of P36035

query
sites
P36035
T
 
T
F
 
W
G
 
G
V
 
L
G
 
G
F
 
L
L
 
V
F
 
L
-
 
F
-
 
V
R
 
R
P
 
S
L
 
A
G
 
G
G
 
A
V
 
V
I
 
I
F
 
F
G
 
G
H
 
L
F
 
W
G
 
T
D
 
D
R
 
K
L
 
S
G
 
S
R
 
R
K
 
K
R
 
W
M
 
P
L
 
Y
M
 
I
L
 
T
T
 
C
V
 
L
W
 
F
M
 
L
M
 
F
G
 
V
I
 
I
A
 
A
T
 
Q
A
 
L
L
 
C
I
 
T
G
 
P
I
 
W
L
 
C
P
 
D
S
 
T
F
 
Y
S
 
E
T
 
K
I
 
-
G
 
-
W
 
-
W
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
F
V
 
L
T
 
G
L
 
V
R
 
R
A
 
W
I
 
I
Q
 
T
G
 
G
F
 
I
A
 
A
V
 
M
G
 
G
G
 
G
E
 
I
W
 
Y
G
 
G
G
 
C
A
 
A
A
 
S
L
 
A
L
 
T
S
 
A
V
 
I
E
 
E
S
 
D
A
 
A
P
 
P
K
 
V
N
 
K
K
 
A
K
 
R
A
 
S
F
 
F
Y
 
L
S
 
S
S
 
G
G
 
L
V
 
F
Q
 
F
V
 
S
G
 
A
Y
 
Y
G
 
A
V
 
M
G
 
G
L
 
F
L
 
I
L
 
F
S
 
A
T
 
I
G
 
I
L
 
F
V
 
Y
S
 
R
L
 
A
I
 
F
S
 
G
M
 
Y
M
 
F
T
 
R
T
 
D
D
 
D
E
 
-
Q
 
-
F
 
-
L
 
-
S
 
-
W
 
-
G
 
G
W
 
W
R
 
K
I
 
I
P
 
L
F
 
F
L
 
W
F
 
F
S
 
S
I
 
I
V
 
F
L
 
L

Sites not aligning to the query:

8jtzA Hoct1 in complex with spironolactone in outward facing partially occluded conformation (see paper)
24% identity, 42% coverage: 68:249/438 of query aligns to 151:339/530 of 8jtzA

query
sites
8jtzA
A
 
S
T
 
C
F
 
L
G
 
N
V
 
A
G
 
G
F
 
F
L
 
L
F
 
F
R
 
G
P
 
S
L
 
L
G
 
G
G
 
-
V
 
-
I
 
-
F
 
V
G
 
G
H
 
Y
F
 
F
G
 
A
D
 
D
R
 
R
L
 
F
G
 
G
R
 
R
K
 
K
R
 
L
M
 
C
L
 
L
M
 
L
L
 
G
T
 
T
V
 
V
W
 
L
M
 
V
M
 
N
G
 
A
I
 
V
A
 
S
T
 
G
A
 
V
L
 
L
I
 
M
G
 
A
I
 
F
L
 
S
P
 
P
S
 
N
F
 
Y
S
 
M
T
 
S
I
 
-
G
 
-
W
 
-
W
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
M
V
 
L
T
 
L
L
 
F
R
 
R
A
 
L
I
 
L
Q
 
Q
G
 
G
F
 
L
A
 
V
V
 
S
G
x
K
G
 
G
E
 
N
W
|
W
G
 
M
G
 
A
A
 
G
A
 
Y
L
 
T
L
 
L
S
 
I
V
 
T
E
 
E
S
 
F
A
 
V
P
 
G
K
 
S
N
 
G
K
 
S
K
 
R
A
 
R
F
 
T
Y
 
V
S
 
A
S
 
I
G
 
M
V
 
Y
Q
|
Q
V
 
M
G
 
A
Y
x
F
G
 
T
V
 
V
G
 
G
L
 
L
L
 
V
L
 
A
S
 
L
T
 
T
G
 
G
L
 
L
-
 
A
-
 
Y
-
 
A
-
 
L
-
 
P
-
 
H
-
 
W
-
 
R
-
 
W
-
 
L
-
 
Q
-
 
L
-
 
A
V
 
V
S
 
S
L
 
L
I
 
P
S
 
T
M
 
F
M
 
L
T
 
-
T
 
-
D
 
-
E
 
-
Q
 
-
F
 
F
L
 
L
S
 
L
W
 
Y
G
 
Y
W
 
W
R
 
C
I
 
V
P
 
P
-
 
E
-
 
S
-
 
P
-
 
R
F
 
W
L
 
L
F
 
L
S
 
S
-
 
Q
-
 
K
-
 
R
-
 
N
-
 
T
-
 
E
I
 
A
V
 
I
L
 
K
V
 
I
L
 
M
G
 
D
A
 
H
L
 
I
W
 
A
V
 
Q
R
 
K
N
 
N
G
 
G
M
 
K
E
 
L
E
 
P
S
 
P
A
 
A
E
 
D
F
 
L
E
 
K
Q
 
M
Q
 
L
Q
 
S
H
 
L
Y
 
E
Q
 
E
A
 
D
A
 
V
A
 
T
K
 
E
K
 
K
R
 
L
I
 
S
P
 
P
V
 
S
I
 
F
E
 
A
A
 
D
L
 
L
L
 
F
R
 
R
H
 
T
P
 
P

Sites not aligning to the query:

O15245 Solute carrier family 22 member 1; Organic cation transporter 1; hOCT1 from Homo sapiens (Human) (see 10 papers)
24% identity, 42% coverage: 68:249/438 of query aligns to 153:341/554 of O15245

query
sites
O15245
A
 
S
T
 
C
F
 
L
G
 
N
V
 
A
G
 
G
F
 
F
L
|
L
F
 
F
R
 
G
P
 
S
L
 
L
G
 
G
G
 
-
V
 
-
I
 
-
F
 
V
G
 
G
H
 
Y
F
 
F
G
 
A
D
 
D
R
 
R
L
 
F
G
 
G
R
 
R
K
 
K
R
 
L
M
 
C
L
 
L
M
 
L
L
 
G
T
 
T
V
 
V
W
 
L
M
 
V
M
 
N
G
 
A
I
 
V
A
x
S
T
 
G
A
 
V
L
 
L
I
 
M
G
 
A
I
 
F
L
 
S
P
 
P
S
 
N
F
 
Y
S
 
M
T
 
S
I
 
-
G
 
-
W
 
-
W
 
-
A
 
-
P
 
-
I
 
-
L
 
-
L
 
M
V
 
L
T
 
L
L
 
F
R
 
R
A
 
L
I
 
L
Q
 
Q
G
 
G
F
 
L
A
 
V
V
 
S
G
 
K
G
 
G
E
 
N
W
 
W
G
 
M
G
 
A
A
x
G
A
 
Y
L
 
T
L
 
L
S
 
I
V
 
T
E
 
E
S
 
F
A
 
V
P
 
G
K
 
S
N
 
G
K
 
S
K
 
R
A
 
R
F
 
T
Y
 
V
S
 
A
S
 
I
G
 
M
V
x
Y
Q
 
Q
V
 
M
G
 
A
Y
 
F
G
 
T
V
 
V
G
 
G
L
 
L
L
 
V
L
 
A
S
 
L
T
 
T
G
 
G
L
 
L
-
 
A
-
 
Y
-
 
A
-
 
L
-
 
P
-
 
H
-
 
W
-
 
R
-
 
W
-
 
L
-
 
Q
-
 
L
-
 
A
V
 
V
S
 
S
L
 
L
I
 
P
S
 
T
M
 
F
M
 
L
T
 
-
T
 
-
D
 
-
E
 
-
Q
 
-
F
 
F
L
 
L
S
 
L
W
 
Y
G
 
Y
W
 
W
R
 
C
I
 
V
P
|
P
-
 
E
-
 
S
-
 
P
-
x
R
F
 
W
L
 
L
F
 
L
S
 
S
-
 
Q
-
 
K
-
 
R
-
 
N
-
 
T
-
 
E
I
 
A
V
 
I
L
 
K
V
 
I
L
 
M
G
 
D
A
 
H
L
 
I
W
 
A
V
 
Q
R
 
K
N
 
N
G
 
G
M
 
K
E
 
L
E
 
P
S
 
P
A
 
A
E
 
D
F
 
L
E
 
K
Q
 
M
Q
 
L
Q
 
S
H
 
L
Y
 
E
Q
 
E
A
 
D
A
 
V
A
 
T
K
 
E
K
 
K
R
 
L
I
 
S
P
 
P
V
 
S
I
 
F
E
 
A
A
 
D
L
 
L
L
 
F
R
 
R
H
 
T
P
|
P

Sites not aligning to the query:

Query Sequence

>16092 FitnessBrowser__Keio:16092
MDSTLISTRPDEGTLSLSRARRAALGSFAGAVVDWYDFLLYGITAALVFNREFFPQVSPA
MGTLAAFATFGVGFLFRPLGGVIFGHFGDRLGRKRMLMLTVWMMGIATALIGILPSFSTI
GWWAPILLVTLRAIQGFAVGGEWGGAALLSVESAPKNKKAFYSSGVQVGYGVGLLLSTGL
VSLISMMTTDEQFLSWGWRIPFLFSIVLVLGALWVRNGMEESAEFEQQQHYQAAAKKRIP
VIEALLRHPGAFLKIIALRLCELLTMYIVTAFALNYSTQNMGLPRELFLNIGLLVGGLSC
LTIPCFAWLADRFGRRRVYITGTLIGTLSAFPFFMALEAQSIFWIVFFSIMLANIAHDMV
VCVQQPMFTEMFGASYRYSGAGVGYQVASVVGGGFTPFIAAALITYFAGNWHSVAIYLLA
GCLISAMTALLMKDSQRA

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory