Comparing 16127 FitnessBrowser__Keio:16127 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1q1kA Structure of atp-phosphoribosyltransferase from e. Coli complexed with pr-atp (see paper)
98% identity, 99% coverage: 5:299/299 of query aligns to 1:288/288 of 1q1kA
1h3dA Structure of the e.Coli atp-phosphoribosyltransferase (see paper)
98% identity, 99% coverage: 5:299/299 of query aligns to 1:288/288 of 1h3dA
4yb7A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
67% identity, 99% coverage: 4:299/299 of query aligns to 1:296/296 of 4yb7A
4yb6A Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
67% identity, 99% coverage: 4:299/299 of query aligns to 1:296/296 of 4yb6A
7dahC Adenosine triphosphate phosphoribosyltransferase from vibrio cholerae in complex with atp and prpp
67% identity, 98% coverage: 6:299/299 of query aligns to 3:288/288 of 7dahC
4yb7C Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with atp (see paper)
66% identity, 99% coverage: 4:299/299 of query aligns to 1:294/294 of 4yb7C
4yb6E Adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni in complex with the inhibitors amp and histidine (see paper)
66% identity, 99% coverage: 4:299/299 of query aligns to 1:293/293 of 4yb6E
5ubgA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound phosphoribosyl-atp (see paper)
64% identity, 74% coverage: 4:225/299 of query aligns to 1:222/222 of 5ubgA
5ub9A Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni (see paper)
64% identity, 74% coverage: 5:225/299 of query aligns to 1:220/220 of 5ub9A
5ubiA Catalytic core domain of adenosine triphosphate phosphoribosyltransferase from campylobacter jejuni with bound prpp (see paper)
63% identity, 73% coverage: 4:221/299 of query aligns to 1:218/218 of 5ubiA
2vd3A The structure of histidine inhibited hisg from methanobacterium thermoautotrophicum
36% identity, 98% coverage: 6:298/299 of query aligns to 4:288/289 of 2vd3A
5lhtA Atp phosphoribosyltransferase from mycobacterium tuberculosis in complex with the allosteric activator 3-(2-thienyl)-l-alanine (see paper)
32% identity, 95% coverage: 7:290/299 of query aligns to 2:275/284 of 5lhtA
1nh8A Atp phosphoribosyltransferase (atp-prtase) from mycobacterium tuberculosis in complex with amp and histidine (see paper)
32% identity, 95% coverage: 7:290/299 of query aligns to 2:267/276 of 1nh8A
5u99A Transition state analysis of adenosine triphosphate phosphoribosyltransferase (see paper)
31% identity, 95% coverage: 7:290/299 of query aligns to 4:269/278 of 5u99A
6czmE Crystal structure of medicago truncatula atp-phosphoribosyltransferase in tense form (see paper)
25% identity, 98% coverage: 7:299/299 of query aligns to 10:328/342 of 6czmE
1z7nF Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis with bound prpp substrate (see paper)
33% identity, 61% coverage: 7:188/299 of query aligns to 2:174/205 of 1z7nF
1z7mE Atp phosphoribosyl transferase (hiszg atp-prtase) from lactococcus lactis (see paper)
32% identity, 61% coverage: 7:188/299 of query aligns to 2:170/200 of 1z7mE
6czmF Crystal structure of medicago truncatula atp-phosphoribosyltransferase in tense form (see paper)
25% identity, 98% coverage: 7:299/299 of query aligns to 3:301/315 of 6czmF
6fcyA Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with prpp and adp
33% identity, 59% coverage: 7:182/299 of query aligns to 4:169/208 of 6fcyA
6fd9A Catalytic subunit hisg from psychrobacter arcticus atp phosphoribosyltransferase (hiszg atpprt) in complex with amp
33% identity, 59% coverage: 7:182/299 of query aligns to 4:169/209 of 6fd9A
>16127 FitnessBrowser__Keio:16127
MTDNTRLRIAMQKSGRLSDDSRELLARCGIKINLHTQRLIAMAENMPIDILRVRDDDIPG
LVMDGVVDLGIIGENVLEEELLNRRAQGEDPRYFTLRRLDFGGCRLSLATPVDEAWDGPL
SLNGKRIATSYPHLLKRYLDQKGISFKSCLLNGSVEVAPRAGLADAICDLVSTGATLEAN
GLREVEVIYRSKACLIQRDGEMEESKQQLIDKLLTRIQGVIQARESKYIMMHAPTERLDE
VIALLPGAERPTILPLAGDQQRVAMHMVSSETLFWETMEKLKALGASSILVLPIEKMME
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory