Comparing 16134 FitnessBrowser__Keio:16134 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
6j2lA Crystal structure of bi-functional enzyme (see paper)
97% identity, 99% coverage: 2:201/203 of query aligns to 1:200/200 of 6j2lA
6j2lB Crystal structure of bi-functional enzyme (see paper)
90% identity, 98% coverage: 3:201/203 of query aligns to 1:185/185 of 6j2lB
7bgnA Crystal structure of mthisn2-amp complex, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
38% identity, 91% coverage: 17:201/203 of query aligns to 15:203/204 of 7bgnA
Sites not aligning to the query:
7bgmA Crystal structure of mthisn2, a bifunctional enzyme from the histidine biosynthetic pathway (see paper)
36% identity, 91% coverage: 17:201/203 of query aligns to 17:212/213 of 7bgmA
>16134 FitnessBrowser__Keio:16134
MLTEQQRRELDWEKTDGLMPVIVQHAVSGEVLMLGYMNPEALDKTLESGKVTFFSRTKQR
LWTKGETSGNFLNVVSIAPDCDNDTLLVLANPIGPTCHKGTSSCFGDTAHQWLFLYQLEQ
LLAERKSADPETSYTAKLYASGTKRIAQKVGEEGVETALAATVHDRFELTNEASDLMYHL
LVLLQDQGLDLTTVIENLRKRHQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory