SitesBLAST
Comparing 16149 FitnessBrowser__Keio:16149 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
88% identity, 100% coverage: 1:361/361 of query aligns to 1:361/361 of 1kewA
- active site: T133 (= T133), D134 (= D134), E135 (= E135), L152 (= L152), L154 (= L154), F155 (= F155), T158 (= T158), Y167 (= Y167), K171 (= K171)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D32), K33 (= K33), L34 (= L34), T35 (= T35), A37 (= A37), G38 (= G38), D58 (= D58), I59 (= I59), L80 (= L80), A81 (= A81), A82 (= A82), S84 (= S84), T99 (= T99), I131 (= I131), S132 (= S132), T133 (= T133), Y167 (= Y167), K171 (= K171), C194 (= C194), N196 (= N196), N197 (= N197)
- binding thymidine-5'-diphosphate: E135 (= E135), N196 (= N196), K206 (= K206), L207 (= L207), P222 (= P222), Y224 (= Y224), R231 (= R231), N266 (= N266), R297 (= R297), H300 (= H300), Y357 (= Y357)
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
88% identity, 100% coverage: 1:361/361 of query aligns to 1:361/361 of 1keuA
- active site: T133 (= T133), D134 (= D134), E135 (= E135), L152 (= L152), L154 (= L154), F155 (= F155), T158 (= T158), Y167 (= Y167), K171 (= K171)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (= S84), T133 (= T133), D134 (= D134), E135 (= E135), Y167 (= Y167), N196 (= N196), K206 (= K206), L207 (= L207), P222 (= P222), Y224 (= Y224), R231 (= R231), N266 (= N266), R297 (= R297), H300 (= H300), Y357 (= Y357)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D32 (= D32), K33 (= K33), L34 (= L34), T35 (= T35), G38 (= G38), D58 (= D58), L80 (= L80), A81 (= A81), A82 (= A82), S84 (= S84), T99 (= T99), S132 (= S132), T133 (= T133), Y167 (= Y167), K171 (= K171), C194 (= C194), N196 (= N196), N197 (= N197)
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
88% identity, 100% coverage: 1:361/361 of query aligns to 1:361/361 of P26391
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
74% identity, 97% coverage: 2:350/361 of query aligns to 3:347/355 of P27830
- FI 12:13 (= FI 11:12) binding
- DKLT 33:36 (= DKLT 32:35) binding
- DI 59:60 (= DI 58:59) binding
- T100 (= T99) binding
- D135 (= D134) active site, Proton donor
- E136 (= E135) active site, Proton acceptor
- Y160 (= Y167) active site, Proton acceptor
- YSASK 160:164 (= YSASK 167:171) binding
- N190 (= N197) binding
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
72% identity, 97% coverage: 2:350/361 of query aligns to 3:341/344 of 1bxkB
- active site: S125 (≠ N124), T134 (= T133), D135 (= D134), E136 (= E135), S158 (= S165), Y160 (= Y167), S161 (= S168), K164 (= K171)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D33 (= D32), K34 (= K33), L35 (= L34), T36 (= T35), A38 (= A37), G39 (= G38), D59 (= D58), I60 (= I59), L81 (= L80), A83 (= A82), T100 (= T99), I132 (= I131), S133 (= S132), T134 (= T133), K164 (= K171), C187 (= C194)
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
55% identity, 98% coverage: 3:357/361 of query aligns to 6:360/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D32), A37 (≠ K33), L38 (= L34), T39 (= T35), G42 (= G38), D62 (= D58), I63 (= I59), L84 (= L80), A85 (= A81), A86 (= A82), T103 (= T99), S143 (= S132), T144 (= T133), Y169 (= Y167), K173 (= K171), C196 (= C194)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
47% identity, 94% coverage: 1:340/361 of query aligns to 2:312/329 of 2hunA
- active site: T125 (= T133), D126 (= D134), E127 (= E135), Y149 (= Y167), K153 (= K171)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D32), K35 (= K33), S40 (≠ G38), D60 (= D58), V61 (≠ I59), L80 (= L80), A81 (= A81), A82 (= A82), S99 (≠ T99), T125 (= T133), K153 (= K171), C176 (= C194), T177 (≠ S195), N178 (= N196), N179 (= N197)
P95780 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
45% identity, 99% coverage: 3:361/361 of query aligns to 7:344/348 of P95780
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
45% identity, 99% coverage: 3:361/361 of query aligns to 6:343/347 of 1kerB
- active site: T124 (= T133), D125 (= D134), E126 (= E135), Y160 (= Y167), K164 (= K171)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (= S84), N87 (≠ V86), T124 (= T133), D125 (= D134), E126 (= E135), Y160 (= Y167), N189 (= N196), K199 (= K206), F200 (≠ L207), R203 (≠ L210), Q204 (≠ V211), K215 (≠ P222), L216 (≠ I223), Y217 (= Y224), R224 (= R231), N259 (= N266), R283 (= R297), H286 (= H300)
- binding nicotinamide-adenine-dinucleotide: G13 (= G10), F14 (= F11), I15 (= I12), D36 (= D32), K37 (= K33), L38 (= L34), T39 (= T35), G42 (= G38), D61 (= D58), I62 (= I59), Y81 (≠ L80), A82 (= A81), A83 (= A82), S85 (= S84), T100 (= T99), S123 (= S132), T124 (= T133), Y160 (= Y167), K164 (= K171), C187 (= C194), N190 (= N197)
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
45% identity, 99% coverage: 3:361/361 of query aligns to 5:342/346 of 1ketA
- active site: T123 (= T133), D124 (= D134), E125 (= E135), Y159 (= Y167), K163 (= K171)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (= D32), K36 (= K33), L37 (= L34), T38 (= T35), A40 (= A37), G41 (= G38), D60 (= D58), I61 (= I59), Y80 (≠ L80), A82 (= A82), S84 (= S84), T99 (= T99), S122 (= S132), T123 (= T133), Y159 (= Y167), K163 (= K171)
- binding thymidine-5'-diphosphate: E125 (= E135), N188 (= N196), F199 (≠ L207), R202 (≠ L210), Q203 (≠ V211), K214 (≠ P222), Y216 (= Y224), R223 (= R231), N258 (= N266), R282 (= R297), H285 (= H300)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
45% identity, 99% coverage: 3:361/361 of query aligns to 5:342/346 of 1kepA
- active site: T123 (= T133), D124 (= D134), E125 (= E135), Y159 (= Y167), K163 (= K171)
- binding nicotinamide-adenine-dinucleotide: G12 (= G10), F13 (= F11), I14 (= I12), D35 (= D32), K36 (= K33), L37 (= L34), T38 (= T35), G41 (= G38), D60 (= D58), I61 (= I59), Y80 (≠ L80), A81 (= A81), A82 (= A82), S84 (= S84), T99 (= T99), S122 (= S132), Y159 (= Y167), K163 (= K171), N189 (= N197)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (= S84), T123 (= T133), E125 (= E135), Y159 (= Y167), N188 (= N196), K198 (= K206), R223 (= R231), R282 (= R297)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
46% identity, 96% coverage: 1:345/361 of query aligns to 1:322/322 of 1r66A
- active site: T127 (= T133), D128 (= D134), E129 (= E135), Y151 (= Y167), K155 (= K171)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D32), S38 (≠ K33), L39 (= L34), T40 (= T35), G43 (= G38), D63 (= D58), I64 (= I59), F83 (≠ L80), A84 (= A81), A85 (= A82), S87 (= S84), T102 (= T99), V125 (≠ I131), S126 (= S132), Y151 (= Y167), K155 (= K171), N181 (= N197)
- binding thymidine-5'-diphosphate: H88 (= H85), E129 (= E135), N180 (= N196), K190 (= K206), L191 (= L207), P206 (= P222), Y208 (= Y224), R215 (= R231), N250 (= N266), R274 (= R297), H277 (= H300)
6bi4C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
43% identity, 94% coverage: 1:340/361 of query aligns to 2:306/311 of 6bi4C
- active site: T117 (= T133), D118 (= D134), E119 (= E135), Y142 (= Y167), K146 (= K171)
- binding beta-D-fructofuranose: Q62 (≠ C60), N63 (≠ D61), G64 (≠ A62), E65 (≠ P63)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D32), A35 (≠ K33), L36 (= L34), T37 (= T35), S39 (≠ A37), G40 (= G38), E60 (≠ D58), I61 (= I59), Q62 (≠ C60), F82 (≠ L80), A83 (= A81), A84 (= A82), T92 (= T99), V115 (≠ I131), T117 (= T133), Y142 (= Y167), K146 (= K171), C169 (= C194), S170 (= S195)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
45% identity, 96% coverage: 1:345/361 of query aligns to 1:322/322 of 1r6dA
- active site: T127 (= T133), N128 (≠ D134), Q129 (≠ E135), Y151 (= Y167), K155 (= K171)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S84), H88 (= H85), T127 (= T133), N128 (≠ D134), Q129 (≠ E135), Y151 (= Y167), N180 (= N196), K190 (= K206), L191 (= L207), P206 (= P222), Y208 (= Y224), R215 (= R231), N250 (= N266), R274 (= R297), H277 (= H300), Y281 (= Y304)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), F11 (= F11), I12 (= I12), D37 (= D32), S38 (≠ K33), L39 (= L34), T40 (= T35), A42 (= A37), G43 (= G38), D63 (= D58), I64 (= I59), F83 (≠ L80), A84 (= A81), A85 (= A82), S87 (= S84), T102 (= T99), V125 (≠ I131), S126 (= S132), Y151 (= Y167), K155 (= K171), N181 (= N197)
6bi4B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
43% identity, 94% coverage: 1:340/361 of query aligns to 2:305/310 of 6bi4B
- active site: T117 (= T133), D118 (= D134), E119 (= E135), Y142 (= Y167), K146 (= K171)
- binding alpha-D-glucopyranose: Q62 (≠ C60), N63 (≠ D61)
- binding nicotinamide-adenine-dinucleotide: G8 (= G7), G11 (= G10), F12 (= F11), I13 (= I12), D34 (= D32), A35 (≠ K33), L36 (= L34), T37 (= T35), S39 (≠ A37), G40 (= G38), E60 (≠ D58), F82 (≠ L80), A83 (= A81), A84 (= A82), T92 (= T99), S116 (= S132), T117 (= T133), Y142 (= Y167), K146 (= K171), C169 (= C194)
8sk0A Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
40% identity, 95% coverage: 2:345/361 of query aligns to 8:325/329 of 8sk0A
- binding nicotinamide-adenine-dinucleotide: G16 (= G10), F17 (= F11), I18 (= I12), D43 (= D32), S44 (≠ K33), L45 (= L34), T46 (= T35), G49 (= G38), D67 (= D58), F87 (≠ L80), A88 (= A81), A89 (= A82), T91 (≠ S84), T106 (= T99), V129 (≠ I131), S130 (= S132), T131 (= T133), Y155 (= Y167), K159 (= K171)
- binding thymidine-5'-diphosphate: E133 (= E135), N184 (= N196), K194 (= K206), V195 (≠ L207), P210 (= P222), Y212 (= Y224), R219 (= R231), N254 (= N266), R278 (= R297), H281 (= H300)
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
40% identity, 95% coverage: 2:345/361 of query aligns to 9:326/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: G17 (= G10), F18 (= F11), I19 (= I12), D44 (= D32), S45 (≠ K33), L46 (= L34), T47 (= T35), G50 (= G38), D68 (= D58), I69 (= I59), F88 (≠ L80), A89 (= A81), A90 (= A82), T92 (≠ S84), T107 (= T99), V130 (≠ I131), Y156 (= Y167), K160 (= K171), G184 (≠ S195), N186 (= N197)
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
40% identity, 96% coverage: 3:348/361 of query aligns to 11:334/667 of Q9LPG6
- G18 (= G10) mutation to A: Abolishes dehydratase activity.
- K36 (≠ S27) mutation to A: Reduces dehydratase activity.
- D96 (= D87) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K171) mutation to A: Abolishes dehydratase activity.
- G193 (= G199) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
40% identity, 96% coverage: 3:348/361 of query aligns to 9:332/669 of Q9SYM5
- R283 (= R297) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
37% identity, 93% coverage: 3:337/361 of query aligns to 6:315/319 of 6vloA
- active site: T126 (= T133), D127 (= D134), E128 (= E135), Y151 (= Y167), K155 (= K171)
- binding nicotinamide-adenine-dinucleotide: G10 (= G7), G13 (= G10), F14 (= F11), I15 (= I12), D36 (≠ T35), I37 (≠ Y36), A42 (≠ E41), D59 (= D58), I60 (= I59), F81 (≠ L80), A82 (= A81), A83 (= A82), S85 (= S84), M124 (≠ I131), T126 (= T133), K155 (= K171)
- binding thymidine-5'-diphosphate: N180 (= N196), K190 (= K206), L191 (= L207), K194 (≠ L210), H206 (≠ P222), Q208 (≠ Y224), R215 (= R231), V250 (≠ N266), R275 (= R297), R281 (= R303)
Query Sequence
>16149 FitnessBrowser__Keio:16149
MKILVTGGAGFIGSAVVRHIINNTQDSVVNVDKLTYAGNRESLADVSDSERYVFEHADIC
DAPAMARIFAQHQPDAVMHLAAESHVDRSITGPAAFIETNIVGTYVLLEAARNYWSALDS
DKKNSFRFHHISTDEVYGDLPHPDEVNNTEELPLFTETTAYAPSSPYSASKASSDHLVRA
WKRTYGLPTIVTNCSNNYGPYHFPEKLIPLVILNALEGKALPIYGKGDQIRDWLYVEDHA
RALYTVVTEGKAGETYNIGGHNEKKNIDVVLTICDLLDEIVPKEKSYREQITYVADRPGH
DRRYAIDAEKIGRALGWKPQETFESGIRKTVEWYLSNTKWVDNVKSGAYQSWIEQNYEGR
Q
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory