Comparing 16150 FitnessBrowser__Keio:16150 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
45% identity, 98% coverage: 5:294/297 of query aligns to 4:289/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
45% identity, 98% coverage: 5:294/297 of query aligns to 4:289/290 of 6k8dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
44% identity, 98% coverage: 5:294/297 of query aligns to 4:284/285 of 6ikzB
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
47% identity, 96% coverage: 5:289/297 of query aligns to 7:283/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
44% identity, 95% coverage: 5:287/297 of query aligns to 5:275/282 of 5ve7A
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
42% identity, 90% coverage: 5:272/297 of query aligns to 7:264/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
40% identity, 90% coverage: 5:272/297 of query aligns to 10:270/281 of 8f73E
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
37% identity, 90% coverage: 5:272/297 of query aligns to 7:231/255 of 2ux8A
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
37% identity, 93% coverage: 5:281/297 of query aligns to 4:265/265 of 3jukA
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
38% identity, 92% coverage: 5:276/297 of query aligns to 4:260/264 of 3jukD
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
34% identity, 97% coverage: 2:288/297 of query aligns to 1:281/291 of 8b6dA
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
33% identity, 97% coverage: 2:288/297 of query aligns to 1:276/286 of 8b68A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
34% identity, 98% coverage: 7:297/297 of query aligns to 7:292/299 of 2pa4B
1lvwA Crystal structure of glucose-1-phosphate thymidylyltransferase, rmla, complex with dtdp
24% identity, 98% coverage: 2:293/297 of query aligns to 2:245/295 of 1lvwA
Sites not aligning to the query:
7d73E Cryo-em structure of gmppa/gmppb complex bound to gtp (state i) (see paper)
24% identity, 94% coverage: 4:283/297 of query aligns to 1:238/360 of 7d73E
7d72K Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
24% identity, 94% coverage: 4:283/297 of query aligns to 1:238/360 of 7d72K
7d72E Cryo-em structures of human gmppa/gmppb complex bound to gdp-mannose (see paper)
24% identity, 94% coverage: 4:283/297 of query aligns to 1:238/360 of 7d72E
1mc3A Crystal structure of rffh (see paper)
24% identity, 80% coverage: 3:239/297 of query aligns to 1:199/291 of 1mc3A
Sites not aligning to the query:
4y7vA Structural analysis of muru (see paper)
29% identity, 45% coverage: 4:136/297 of query aligns to 1:111/216 of 4y7vA
Sites not aligning to the query:
Q88QT2 N-acetylmuramate alpha-1-phosphate uridylyltransferase; MurNAc-1P uridylyltransferase; MurNAc-alpha-1P uridylyltransferase; EC 2.7.7.99 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
29% identity, 45% coverage: 4:136/297 of query aligns to 1:111/223 of Q88QT2
Sites not aligning to the query:
>16150 FitnessBrowser__Keio:16150
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILCARPA
IGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSVIQTK
EPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLSE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory