Comparing 16166 FitnessBrowser__Keio:16166 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
38% identity, 86% coverage: 20:158/162 of query aligns to 105:232/233 of 4n6bA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
37% identity, 86% coverage: 20:158/162 of query aligns to 112:242/243 of 4n69A
7ra4A Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) in complex with serine (see paper)
42% identity, 63% coverage: 56:157/162 of query aligns to 139:241/243 of 7ra4A
Sites not aligning to the query:
6wyeA Crystal structure of neisseria gonorrhoeae serine acetyltransferase (cyse) (see paper)
42% identity, 63% coverage: 56:157/162 of query aligns to 141:243/261 of 6wyeA
Sites not aligning to the query:
8i09A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with butyl gallate (see paper)
34% identity, 86% coverage: 20:158/162 of query aligns to 112:242/246 of 8i09A
Sites not aligning to the query:
8i06A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with coa (see paper)
34% identity, 86% coverage: 20:158/162 of query aligns to 113:243/244 of 8i06A
Sites not aligning to the query:
8i04A Crystal structure of serine acetyltransferase from salmonella typhimurium complexed with serine (see paper)
34% identity, 86% coverage: 20:158/162 of query aligns to 109:239/258 of 8i04A
Sites not aligning to the query:
3gvdI Crystal structure of serine acetyltransferase cyse from yersinia pestis
35% identity, 86% coverage: 20:158/162 of query aligns to 116:246/272 of 3gvdI
Sites not aligning to the query:
4h7oA Crystal structure of serine acetyltransferase from vibrio cholerae o1 biovar el tor n16961
34% identity, 85% coverage: 21:158/162 of query aligns to 110:239/258 of 4h7oA
Sites not aligning to the query:
4hzdA Crystal structure of serine acetyltransferase in complex with coenzyme a from brucella abortus strain s19 (see paper)
32% identity, 91% coverage: 12:158/162 of query aligns to 105:243/250 of 4hzdA
Sites not aligning to the query:
1t3dA Crystal structure of serine acetyltransferase from e.Coli at 2.2a (see paper)
33% identity, 86% coverage: 20:158/162 of query aligns to 113:243/262 of 1t3dA
Sites not aligning to the query:
1ssqD Serine acetyltransferase- complex with cysteine (see paper)
32% identity, 87% coverage: 18:158/162 of query aligns to 107:239/257 of 1ssqD
Sites not aligning to the query:
1sstA Serine acetyltransferase- complex with coa (see paper)
31% identity, 79% coverage: 31:158/162 of query aligns to 85:232/233 of 1sstA
Sites not aligning to the query:
7bw9A Crystal structure of serine acetyltransferase isoform 3 in complex with cysteine from entamoeba histolytica
32% identity, 65% coverage: 57:162/162 of query aligns to 163:269/280 of 7bw9A
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
36% identity, 61% coverage: 60:158/162 of query aligns to 25:139/290 of 4mzuB
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
36% identity, 61% coverage: 60:158/162 of query aligns to 25:140/294 of 4mzuF
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
25% identity, 91% coverage: 12:158/162 of query aligns to 26:180/200 of 1krrA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
25% identity, 91% coverage: 12:158/162 of query aligns to 27:181/203 of P07464
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
25% identity, 91% coverage: 12:158/162 of query aligns to 26:180/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
25% identity, 91% coverage: 12:158/162 of query aligns to 26:180/201 of 1kruA
Sites not aligning to the query:
>16166 FitnessBrowser__Keio:16166
MLEDLRANSWSLRPCCMVLAYRVAHFCSVWRKKNVLNNLWAAPLLVLYRIITECFFGYEI
QAAATIGRRFTIHHGYAVVINKNVVAGDDFTIRHGVTIGNRGADNMACPHIGNGVELGAN
VIILGDITLGNNVTVGAGSVVLDSVPDNALVVGEKARVKVIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory