SitesBLAST
Comparing 16198 FitnessBrowser__Keio:16198 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4uejA Closed state of galactitol-1-phosphate 5-dehydrogenase from e. Coli in complex with glycerol. (see paper)
100% identity, 100% coverage: 1:346/346 of query aligns to 1:346/346 of 4uejA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), P43 (= P43), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), D107 (= D107), P145 (= P145), G149 (= G149), K341 (= K341)
- binding glycerol: H59 (= H59), E144 (= E144)
- binding zinc ion: C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103)
4a2cA Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli (see paper)
100% identity, 100% coverage: 1:346/346 of query aligns to 1:346/346 of 4a2cA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), P43 (= P43), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), D107 (= D107), P145 (= P145), G149 (= G149), K341 (= K341)
- binding zinc ion: C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103)
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
32% identity, 100% coverage: 1:346/346 of query aligns to 4:342/343 of 4ej6A
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (≠ P43), H61 (= H59), E62 (= E60), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), R109 (≠ D107), P147 (= P145), C151 (≠ G149), K337 (= K341)
- binding zinc ion: C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103)
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
32% identity, 100% coverage: 1:346/346 of query aligns to 4:342/342 of 4ejmA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (≠ P43), H61 (= H59), E62 (= E60), C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103), R109 (≠ D107), P147 (= P145), C151 (≠ G149), K337 (= K341)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G168), G172 (= G170), V173 (≠ T171), I174 (= I172), T194 (≠ D192), R195 (≠ I193), Q196 (≠ S194), K199 (= K197), C240 (≠ T236), E245 (≠ Q241), T246 (= T242), L263 (≠ V259), V265 (≠ T261), I291 (≠ M288)
- binding zinc ion: C91 (= C89), C94 (= C92), C97 (= C95), C105 (= C103)
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
29% identity, 95% coverage: 10:336/346 of query aligns to 12:334/347 of 5vm2A
- active site: C39 (= C38), G40 (= G39), S41 (= S40), H44 (≠ R44), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), D113 (= D107), P153 (= P145), G157 (= G149)
- binding magnesium ion: H65 (= H59), E66 (= E60), E152 (= E144)
- binding zinc ion: C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103)
Sites not aligning to the query:
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
32% identity, 95% coverage: 1:330/346 of query aligns to 4:320/337 of 4ilkA
- active site: C40 (= C38), G41 (= G39), S42 (= S40), H45 (≠ R44), H59 (= H59), E60 (= E60), C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103), A107 (≠ D107), P145 (= P145), A149 (≠ G149)
- binding manganese (ii) ion: C40 (= C38), H59 (= H59), E60 (= E60), E144 (= E144)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G168), G170 (= G170), P171 (≠ T171), I172 (= I172), D193 (= D192), R194 (≠ I193), R198 (≠ K197), N213 (≠ S212), A235 (≠ T236), A236 (= A237), C237 (≠ G238), I241 (≠ T242), M258 (≠ V259), F260 (≠ T261)
- binding zinc ion: C89 (= C89), C92 (= C92), C95 (= C95), C103 (= C103)
Sites not aligning to the query:
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
30% identity, 88% coverage: 27:329/346 of query aligns to 27:325/343 of 2ejvA
- active site: C38 (= C38), G39 (= G39), T40 (≠ S40), H43 (≠ R44), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C99 (= C95), C107 (= C103), Q111 (≠ D107), P149 (= P145), A153 (≠ G149)
- binding nicotinamide-adenine-dinucleotide: G172 (= G168), G174 (= G170), P175 (≠ T171), I176 (= I172), S195 (≠ I191), D196 (= D192), P197 (≠ I193), R201 (≠ K197), F238 (≠ T236), S239 (≠ A237), N241 (≠ V239), A244 (≠ T242), L261 (≠ V259), G262 (= G260), I263 (≠ T261)
- binding zinc ion: C38 (= C38), H63 (= H59), E64 (= E60), C96 (= C92), C99 (= C95), C107 (= C103)
Sites not aligning to the query:
2dq4A Crystal structure of threonine 3-dehydrogenase
30% identity, 88% coverage: 27:329/346 of query aligns to 27:325/343 of 2dq4A
- active site: C38 (= C38), G39 (= G39), T40 (≠ S40), H43 (≠ R44), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C99 (= C95), C107 (= C103), Q111 (≠ D107), P149 (= P145), A153 (≠ G149)
- binding zinc ion: C38 (= C38), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C107 (= C103)
Sites not aligning to the query:
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
30% identity, 88% coverage: 27:329/346 of query aligns to 27:325/343 of Q5SKS4
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
30% identity, 91% coverage: 20:335/346 of query aligns to 22:344/357 of 7y9pA
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
30% identity, 92% coverage: 27:346/346 of query aligns to 29:345/347 of 3gfbA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H51), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), K113 (≠ D107), P151 (= P145), A155 (≠ G149), K340 (= K341)
- binding nicotinamide-adenine-dinucleotide: G173 (= G168), G175 (= G170), P176 (≠ T171), L177 (≠ I172), S196 (≠ I191), E197 (≠ D192), P198 (≠ I193), R202 (≠ K197), F241 (≠ T236), S242 (≠ A237), A244 (≠ V239), L264 (≠ V259), G265 (= G260), L266 (≠ T261), I289 (≠ M288), T290 (≠ N289)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
30% identity, 92% coverage: 27:346/346 of query aligns to 31:347/350 of Q5JI69
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
30% identity, 92% coverage: 27:345/346 of query aligns to 31:346/348 of O58389
- C42 (= C38) binding
- T44 (≠ S40) mutation to A: Total loss of enzymatic activity.
- H67 (= H59) binding
- E68 (= E60) binding
- C97 (= C89) binding
- C100 (= C92) binding
- C103 (= C95) binding
- C111 (= C103) binding
- E152 (= E144) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I172) binding
- E199 (≠ D192) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (≠ K197) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ VGT 259:261) binding
- IT 291:292 (≠ MN 288:289) binding
- R294 (≠ S291) mutation to A: 4000-fold decrease in catalytic efficiency.
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
30% identity, 92% coverage: 27:345/346 of query aligns to 29:344/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (≠ S40), H45 (= H51), H65 (= H59), E66 (= E60), C95 (= C89), C98 (= C92), C101 (= C95), C109 (= C103), K113 (≠ D107), P151 (= P145), A155 (≠ G149), K340 (= K341)
- binding nicotinamide-adenine-dinucleotide: G175 (= G170), P176 (≠ T171), L177 (≠ I172), E197 (≠ D192), P198 (≠ I193), R202 (≠ K197), F241 (≠ T236), S242 (≠ A237), A244 (≠ V239), L264 (≠ V259), G265 (= G260), L266 (≠ T261), I289 (≠ M288), T290 (≠ N289)
- binding zinc ion: C95 (= C89), C101 (= C95), C109 (= C103)
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
30% identity, 95% coverage: 3:329/346 of query aligns to 9:331/354 of P07846
- C43 (= C38) binding
- Y49 (= Y52) binding
- H67 (= H59) binding
- E68 (= E60) binding
- E153 (= E144) binding
- R296 (≠ N289) binding
- Y297 (= Y290) binding
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
30% identity, 95% coverage: 3:329/346 of query aligns to 5:328/351 of 3qe3A
- active site: C39 (= C38), G40 (= G39), S41 (= S40), H44 (= H51), H64 (= H59), E65 (= E60), R94 (≠ C89), D97 (≠ C92), C100 (= C95), S108 (≠ C103), F112 (≠ D107), P151 (= P145), G155 (= G149)
- binding glycerol: Y45 (= Y52), F54 (vs. gap), T116 (≠ S111), R293 (≠ N289)
- binding zinc ion: C39 (= C38), H64 (= H59), E65 (= E60)
Sites not aligning to the query:
4oh1A Crystal structure of a putative zinc-binding dehydrogenase (gutb) from clostridium scindens atcc 35704 at 2.00 a resolution
32% identity, 71% coverage: 6:249/346 of query aligns to 15:261/351 of 4oh1A
- active site: C46 (= C38), G47 (= G39), S48 (= S40), H51 (vs. gap), H74 (= H59), E75 (= E60), C106 (= C89), C109 (= C92), C112 (= C95), C120 (= C103), P158 (= P145), A162 (≠ G149)
- binding zinc ion: C46 (= C38), H74 (= H59), E75 (= E60), C106 (= C89), C109 (= C92), C112 (= C95), C120 (= C103), E157 (= E144)
Sites not aligning to the query:
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
29% identity, 92% coverage: 12:329/346 of query aligns to 13:328/348 of 1e3jA
- active site: C38 (= C38), G39 (= G39), S40 (= S40), H43 (= H51), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C99 (= C95), C107 (= C103), T111 (≠ D107), P150 (= P145), G154 (= G149)
- binding phosphate ion: A174 (= A169), A196 (≠ D192), R197 (≠ I193), S198 (= S194), R201 (≠ K197)
- binding zinc ion: C38 (= C38), H63 (= H59), E64 (= E60), C93 (= C89), C96 (= C92), C99 (= C95), C107 (= C103)
Sites not aligning to the query:
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
27% identity, 94% coverage: 19:344/346 of query aligns to 20:338/341 of P07913
- C38 (= C38) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
27% identity, 96% coverage: 3:335/346 of query aligns to 11:340/357 of Q00796
- C45 (= C38) binding
- H70 (= H59) binding
- E71 (= E60) binding
- R110 (≠ F99) to P: in SORDD; results in protein aggregation
- H135 (≠ V123) to R: in SORDD; results in protein aggregation
- A153 (= A141) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I172) binding
- D204 (= D192) binding
- R209 (≠ K197) binding
- Q239 (≠ N230) to L: in dbSNP:rs1042079
- N269 (≠ Q255) to T: in dbSNP:rs930337
- VGL 273:275 (≠ VGT 259:261) binding
- VF-R 297:299 (≠ SWMN 286:289) binding
- V322 (≠ I317) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>16198 FitnessBrowser__Keio:16198
MKSVVNDTDGIVRVAESVIPEIKHQDEVRVKIASSGLCGSDLPRIFKNGAHYYPITLGHE
FSGYIDAVGSGVDDLHPGDAVACVPLLPCFTCPECLKGFYSQCAKYDFIGSRRDGGFAEY
IVVKRKNVFALPTDMPIEDGAFIEPITVGLHAFHLAQGCENKNVIIIGAGTIGLLAIQCA
VALGAKSVTAIDISSEKLALAKSFGAMQTFNSSEMSAPQMQSVLRELRFNQLILETAGVP
QTVELAVEIAGPHAQLALVGTLHQDLHLTSATFGKILRKELTVIGSWMNYSSPWPGQEWE
TASRLLTERKLSLEPLIAHRGSFESFAQAVRDIARNAMPGKVLLIP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory