SitesBLAST
Comparing 16348 FitnessBrowser__Keio:16348 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
31% identity, 71% coverage: 10:396/542 of query aligns to 75:484/629 of Q9SS48
- S86 (≠ A21) mutation to F: In spd6-2; loss of 90% of activity.
Sites not aligning to the query:
- 546 E→G: In spd6-1; loss of 90% of activity.
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
28% identity, 62% coverage: 31:365/542 of query aligns to 41:393/557 of 2rgoA
- binding flavin-adenine dinucleotide: E48 (= E38), M49 (≠ R39), Q50 (≠ H40), T56 (≠ A46), S57 (≠ T47), A197 (≠ V174), S232 (≠ A209), G233 (= G210), W235 (= W212), G257 (= G231), G344 (= G313), L345 (≠ V314), Y357 (≠ P324), K382 (= K354), I383 (≠ L355), T384 (≠ M356)
Sites not aligning to the query:
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
27% identity, 62% coverage: 31:365/542 of query aligns to 39:385/530 of 2rgoB
- binding flavin-adenine dinucleotide: E46 (= E38), M47 (≠ R39), Q48 (≠ H40), T54 (≠ A46), S55 (≠ T47), S58 (≠ N50), T59 (≠ H51), A193 (≠ V174), S227 (≠ A209), G228 (= G210), W230 (= W212), L338 (≠ V314), R339 (= R315), Y350 (≠ V329), K374 (= K354), I375 (≠ L355), T376 (≠ M356)
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
28% identity, 67% coverage: 26:388/542 of query aligns to 36:354/496 of 3da1A
- binding flavin-adenine dinucleotide: E48 (= E38), M49 (≠ R39), G55 (= G45), S57 (≠ T47), S60 (≠ N50), T61 (≠ H51), L63 (= L53), H65 (= H55), V151 (= V174), G187 (= G210), W189 (= W212), L193 (≠ I216), G210 (= G231), T250 (= T268), G296 (= G313), R298 (= R315), G319 (= G353), K320 (= K354), L321 (= L355)
Sites not aligning to the query:
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
26% identity, 66% coverage: 32:388/542 of query aligns to 27:388/495 of 2r46A
- binding flavin-adenine dinucleotide: L32 (≠ V37), E33 (= E38), A34 (≠ R39), T41 (≠ A46), S42 (≠ T47), A44 (≠ R49), S45 (≠ N50), S46 (≠ H51), L48 (= L53), A172 (≠ V174), T206 (≠ A209), G231 (= G231), R317 (= R315), G353 (= G353), K354 (= K354), L355 (= L355), T356 (≠ M356)
- binding phosphoenolpyruvate: R54 (= R59), Y55 (= Y60), R254 (≠ S252), T270 (= T268), D272 (≠ S270), R317 (= R315), R332 (= R331)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ L159)
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
26% identity, 66% coverage: 32:388/542 of query aligns to 27:388/495 of 2r45A
- binding 2-phosphoglyceric acid: R54 (= R59), Y55 (= Y60), R254 (≠ S252), I255 (≠ D253), T270 (= T268), R317 (= R315), R332 (= R331)
- binding flavin-adenine dinucleotide: E33 (= E38), A34 (≠ R39), C39 (≠ T44), A40 (≠ G45), T41 (≠ A46), S42 (≠ T47), A44 (≠ R49), S45 (≠ N50), S46 (≠ H51), L48 (= L53), A172 (≠ V174), T206 (≠ A209), G207 (= G210), W209 (= W212), G231 (= G231), R317 (= R315), G353 (= G353), K354 (= K354), L355 (= L355), T356 (≠ M356)
- binding phosphate ion: Q212 (vs. gap), G277 (vs. gap), P279 (≠ I278), V310 (≠ L308)
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: Q157 (≠ L159), V160 (≠ K162)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 9, 12, 13, 14
- binding phosphate ion: 398, 401, 405, 462, 464, 468
- binding n-(tris(hydroxymethyl)methyl)-3-aminopropanesulfonic acid: 455, 456, 457, 459
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
26% identity, 66% coverage: 32:388/542 of query aligns to 27:388/501 of 2qcuB
- binding flavin-adenine dinucleotide: E33 (= E38), A34 (≠ R39), C39 (≠ T44), T41 (≠ A46), S42 (≠ T47), S45 (≠ N50), S46 (≠ H51), L48 (= L53), H50 (= H55), A172 (≠ V174), T206 (≠ A209), W209 (= W212), G231 (= G231), R317 (= R315), G353 (= G353), K354 (= K354), L355 (= L355), T356 (≠ M356)
- binding phosphate ion: R54 (= R59), Y55 (= Y60), R317 (= R315), R332 (= R331)
Sites not aligning to the query:
1y56B Crystal structure of l-proline dehydrogenase from p.Horikoshii (see paper)
27% identity, 37% coverage: 24:226/542 of query aligns to 20:217/374 of 1y56B
- active site: F44 (≠ G48), G47 (≠ H55), T48 (≠ S56)
- binding flavin-adenine dinucleotide: I33 (≠ V37), E34 (= E38), K35 (≠ R39), S42 (≠ A46), T43 (= T47), R45 (= R49), C46 (≠ L54), G47 (≠ H55), G49 (= G57), E170 (= E173), V171 (= V174), T200 (≠ A209), N201 (≠ G210), W203 (= W212)
- binding flavin mononucleotide: F44 (≠ G48), R45 (= R49)
Sites not aligning to the query:
- active site: 224, 239, 305, 338
- binding flavin-adenine dinucleotide: 11, 13, 14, 15, 305, 306, 307, 334, 335, 336, 337, 338
- binding flavin mononucleotide: 260, 301, 303
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 42% coverage: 9:235/542 of query aligns to 43:267/857 of Q63342
- CV 52:53 (≠ AT 18:19) binding
- EK 73:74 (≠ ER 38:39) binding
- 80:88 (vs. 45:53, 44% identical) binding
- H84 (≠ R49) modified: Tele-8alpha-FAD histidine
- V212 (= V184) binding
- W244 (= W212) binding
Sites not aligning to the query:
- 390:395 binding
- 573:575 binding
- 669 binding
- 676:678 binding
- 737 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
24% identity, 42% coverage: 9:235/542 of query aligns to 6:230/824 of 4pabB
- active site: T53 (vs. gap), E102 (≠ S102), H226 (≠ G231)
- binding flavin-adenine dinucleotide: I11 (= I14), G12 (= G15), G14 (= G17), C15 (≠ A18), V16 (≠ T19), L35 (≠ V37), E36 (= E38), K37 (≠ R39), G43 (= G45), S44 (≠ A46), T45 (= T47), H47 (≠ R49), A48 (≠ N50), A49 (≠ H51), G50 (= G52), L51 (= L53), V175 (= V184), A204 (= A209), G205 (= G210), W207 (= W212), H226 (≠ G231), Y228 (≠ L233)
Sites not aligning to the query:
- active site: 255, 536
- binding flavin-adenine dinucleotide: 326, 328, 353, 355, 356, 357, 358
- binding (6s)-5,6,7,8-tetrahydrofolate: 523, 536, 538, 550, 612, 613, 632, 639, 680, 700
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
24% identity, 43% coverage: 2:235/542 of query aligns to 43:274/866 of Q9UI17
- CV 59:60 (≠ AT 18:19) binding
- EK 80:81 (≠ ER 38:39) binding
- 87:95 (vs. 45:53, 44% identical) binding
- H91 (≠ R49) modified: Tele-8alpha-FAD histidine
- H109 (≠ D64) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V184) binding
Sites not aligning to the query:
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
30% identity, 42% coverage: 10:239/542 of query aligns to 3:230/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I14), G8 (= G15), G10 (= G17), V11 (≠ A18), I12 (≠ T19), V30 (= V37), E31 (= E38), K32 (≠ R39), E38 (≠ G45), A39 (= A46), S40 (≠ T47), A43 (≠ N50), G45 (= G52), L46 (= L53), V171 (= V174), G200 (≠ A209), G201 (= G210), W203 (= W212)
Sites not aligning to the query:
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
26% identity, 58% coverage: 10:325/542 of query aligns to 4:324/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (= I14), G9 (= G15), G11 (= G17), V12 (≠ A18), V13 (≠ T19), E32 (= E38), A33 (≠ R39), T41 (≠ A46), S42 (≠ T47), R44 (= R49), N45 (= N50), S46 (≠ H51), V48 (≠ L53), H50 (= H55), P170 (≠ H172), L171 (≠ E173), A203 (= A209), I313 (≠ V314), R314 (= R315)
Sites not aligning to the query:
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
22% identity, 40% coverage: 11:228/542 of query aligns to 4:219/827 of 1pj7A
- binding flavin-adenine dinucleotide: G8 (= G15), G10 (= G17), I11 (≠ A18), V12 (≠ T19), D32 (≠ R39), Q33 (≠ H40), G41 (= G45), S42 (≠ A46), T43 (= T47), H45 (≠ R49), P47 (≠ H51), L49 (= L53), T170 (≠ E173), V171 (= V174), A200 (= A209), G201 (= G210), W203 (= W212)
Sites not aligning to the query:
- active site: 222, 256, 549
- binding flavin-adenine dinucleotide: 222, 256, 331, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
22% identity, 40% coverage: 11:228/542 of query aligns to 5:220/828 of 1pj6A
- binding flavin-adenine dinucleotide: G9 (= G15), G11 (= G17), I12 (≠ A18), V13 (≠ T19), D33 (≠ R39), Q34 (≠ H40), G42 (= G45), S43 (≠ A46), T44 (= T47), H46 (≠ R49), P48 (≠ H51), L50 (= L53), V172 (= V174), A201 (= A209), G202 (= G210), W204 (= W212)
Sites not aligning to the query:
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
22% identity, 40% coverage: 11:228/542 of query aligns to 4:219/827 of 3gsiA
- binding flavin-adenine dinucleotide: G10 (= G17), I11 (≠ A18), V12 (≠ T19), D32 (≠ R39), Q33 (≠ H40), G41 (= G45), S42 (≠ A46), T43 (= T47), H45 (≠ R49), P47 (≠ H51), L49 (= L53), T170 (≠ E173), V171 (= V174), A200 (= A209), G201 (= G210), W203 (= W212)
Sites not aligning to the query:
- active site: 222, 256, 549
- binding flavin-adenine dinucleotide: 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
22% identity, 40% coverage: 11:228/542 of query aligns to 7:222/830 of Q9AGP8
Sites not aligning to the query:
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
23% identity, 59% coverage: 7:324/542 of query aligns to 23:331/383 of 5i39A
- active site: F66 (≠ N50), Q69 (≠ L53), A70 (≠ L54), Q248 (≠ G231), P267 (≠ I266)
- binding flavin-adenine dinucleotide: V30 (≠ I14), G31 (= G15), G33 (= G17), I34 (≠ A18), L35 (≠ T19), V53 (= V37), E54 (= E38), K55 (≠ R39), Q62 (≠ A46), S63 (≠ T47), F66 (≠ N50), Y67 (≠ H51), Q69 (≠ L53), A196 (≠ E173), A197 (≠ V174), G226 (≠ A209), G227 (= G210), W229 (= W212), Q248 (≠ G231), Q250 (= Q242), G321 (= G313), M323 (≠ R315)
Sites not aligning to the query:
Query Sequence
>16348 FitnessBrowser__Keio:16348
MKTRDSQSSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTNGLFITLPEDDLSFQATFIRACEEAGISAEA
IDPQQARIIEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAKEHGAVILTAHEVTGLIRE
GATVCGVRVRNHLTGETQALHAPVVVNAAGIWGQHIAEYADLRIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSLRIDYNEIDDNRVTAEEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLLDHAERDGLDGFITITGGKLMTYRL
MAEWATDAVCRKLGNTRPCTTADLALPGSQEPAEVTLRKVISLPAPLRGSAVYRHGDRTP
AWLSEGRLHRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNVTTSAQSIEQLSTFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEQKD
AL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory