SitesBLAST
Comparing 16369 FitnessBrowser__Keio:16369 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4i42A E.Coli. 1,4-dihydroxy-2-naphthoyl coenzyme a synthase (ecmenb) in complex with 1-hydroxy-2-naphthoyl-coa (see paper)
100% identity, 100% coverage: 1:285/285 of query aligns to 1:285/285 of 4i42A
- active site: G86 (= G86), R91 (= R91), Y97 (= Y97), H105 (= H105), L109 (= L109), G133 (= G133), V136 (= V136), G156 (= G156), S161 (= S161), D163 (= D163), G164 (= G164), A250 (= A250), Y258 (= Y258)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (= V44), R45 (= R45), S84 (= S84), G85 (= G85), G86 (= G86), D87 (= D87), Q88 (= Q88), K89 (= K89), Y97 (= Y97), V108 (= V108), Y129 (= Y129), G133 (= G133), T155 (= T155), S161 (= S161), T254 (= T254), F270 (= F270), K273 (= K273)
P0ABU0 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Escherichia coli (strain K12) (see 4 papers)
100% identity, 100% coverage: 1:285/285 of query aligns to 1:285/285 of P0ABU0
- R45 (= R45) binding in other chain
- SGGDQK 84:89 (= SGGDQK 84:89) binding in other chain
- K89 (= K89) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- R91 (= R91) mutation to A: Loss of DHNA-CoA synthase activity.
- Y97 (= Y97) binding in other chain; mutation to F: Loss of DHNA-CoA synthase activity.
- YSIGG 129:133 (= YSIGG 129:133) binding in other chain
- Q154 (= Q154) mutation to A: Reduces the specific DHNA-CoA synthase activity by 15-fold, whereas its affinity for hydrogencarbonate is reduced by 36-fold.
- QTG 154:156 (= QTG 154:156) binding
- T155 (= T155) binding in other chain
- G156 (= G156) mutation to D: Loss of DHNA-CoA synthase activity.
- S161 (= S161) binding in other chain
- W184 (= W184) mutation to F: Reduces the specific DHNA-CoA synthase activity by 530-fold, whereas its affinity for hydrogencarbonate is reduced by 20-fold.
- Y258 (= Y258) binding
- R267 (= R267) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- F270 (= F270) mutation to A: Strongly decreases affinity for substrate and DHNA-CoA synthase activity.
- K273 (= K273) binding ; mutation to A: Impairs protein folding.
3t88A Crystal structure of escherichia coli menb in complex with substrate analogue, osb-ncoa (see paper)
100% identity, 99% coverage: 5:285/285 of query aligns to 1:281/281 of 3t88A
- active site: G82 (= G86), R87 (= R91), Y93 (= Y97), H101 (= H105), L105 (= L109), G129 (= G133), V132 (= V136), G152 (= G156), S157 (= S161), D159 (= D163), G160 (= G164), A246 (= A250), Y254 (= Y258)
- binding o-succinylbenzoyl-N-coenzyme A: Q39 (= Q43), V40 (= V44), R41 (= R45), A43 (= A47), S80 (= S84), G81 (= G85), G82 (= G86), D83 (= D87), Q84 (= Q88), K85 (= K89), Y93 (= Y97), V104 (= V108), L105 (= L109), Y125 (= Y129), G129 (= G133), T151 (= T155), V155 (= V159), F158 (= F162), D159 (= D163), T250 (= T254), Y254 (= Y258), F266 (= F270), K269 (= K273)
Q7CQ56 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
97% identity, 100% coverage: 1:285/285 of query aligns to 1:285/285 of Q7CQ56
4elxA Structure of apo e.Coli. 1,4-dihydroxy-2- naphthoyl coa synthases with cl (see paper)
95% identity, 99% coverage: 4:285/285 of query aligns to 1:268/268 of 4elxA
- active site: G83 (= G86), H88 (= H105), L92 (= L109), G116 (= G133), V119 (= V136), G139 (= G156), S144 (= S161), D146 (= D163), G147 (= G164), A233 (= A250), Y241 (= Y258)
- binding chloride ion: G115 (= G132), G139 (= G156), W167 (= W184)
4elwA Structure of e. Coli. 1,4-dihydroxy-2- naphthoyl coenzyme a synthases (menb) in complex with nitrate (see paper)
95% identity, 99% coverage: 4:285/285 of query aligns to 1:267/267 of 4elwA
- active site: G83 (= G86), L91 (= L109), G115 (= G133), V118 (= V136), G138 (= G156), S143 (= S161), D145 (= D163), G146 (= G164), A232 (= A250), Y240 (= Y258)
- binding nitrate ion: G114 (= G132), T137 (= T155), G138 (= G156), F144 (= F162), W166 (= W184)
3h02A 2.15 angstrom resolution crystal structure of naphthoate synthase from salmonella typhimurium.
92% identity, 99% coverage: 5:285/285 of query aligns to 1:266/266 of 3h02A
- active site: G82 (= G86), H86 (= H105), L90 (= L109), G114 (= G133), V117 (= V136), G137 (= G156), S142 (= S161), D144 (= D163), G145 (= G164), A231 (= A250), Y239 (= Y258)
- binding bicarbonate ion: G113 (= G132), Q135 (= Q154), G137 (= G156), W165 (= W184)
4i52A Scmenb im complex with 1-hydroxy-2-naphthoyl-coa (see paper)
67% identity, 96% coverage: 13:285/285 of query aligns to 1:275/275 of 4i52A
- active site: G77 (= G86), R82 (= R91), Y87 (= Y97), R95 (≠ H105), L99 (= L109), G123 (= G133), V126 (= V136), G146 (= G156), S151 (= S161), D153 (= D163), G154 (= G164), A240 (= A250), Y248 (= Y258)
- binding 1-hydroxy-2-naphthoyl-CoA: H29 (≠ Q43), K30 (≠ V44), R31 (= R45), A33 (= A47), S75 (= S84), G76 (= G85), G77 (= G86), D78 (= D87), Q79 (= Q88), L96 (= L106), V98 (= V108), Y119 (= Y129), I121 (= I131), G123 (= G133), T145 (= T155), V149 (= V159), S151 (= S161), F152 (= F162)
4i4zA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with salicylyl-coa (see paper)
67% identity, 96% coverage: 13:285/285 of query aligns to 1:275/275 of 4i4zA
- active site: G77 (= G86), R82 (= R91), Y87 (= Y97), R95 (≠ H105), L99 (= L109), G123 (= G133), V126 (= V136), G146 (= G156), S151 (= S161), D153 (= D163), G154 (= G164), A240 (= A250), Y248 (= Y258)
- binding Salicylyl CoA: H29 (≠ Q43), K30 (≠ V44), R31 (= R45), S75 (= S84), G76 (= G85), G77 (= G86), D78 (= D87), Q79 (= Q88), Y87 (= Y97), V98 (= V108), G123 (= G133), T145 (= T155), V149 (= V159), S151 (= S161), F260 (= F270), K263 (= K273)
- binding bicarbonate ion: G122 (= G132), Q144 (= Q154), T145 (= T155), G146 (= G156), W174 (= W184)
Q8GYN9 1,4-dihydroxy-2-naphthoyl-CoA synthase, peroxisomal; DHNS; Enoyl-CoA hydratase/isomerase D; ECHID; Naphthoate synthase; EC 4.1.3.36 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
69% identity, 93% coverage: 22:285/285 of query aligns to 74:337/337 of Q8GYN9
Sites not aligning to the query:
- 20 H→V: Loss of peroxisomal targeting.
Q5HH38 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Staphylococcus aureus (strain COL) (see paper)
65% identity, 95% coverage: 14:285/285 of query aligns to 5:273/273 of Q5HH38
- R34 (= R45) binding in other chain
- SGGDQ 73:77 (= SGGDQ 84:88) binding in other chain
- S149 (= S161) binding in other chain
2uzfA Crystal structure of staphylococcus aureus 1,4-dihydroxy-2-naphthoyl coa synthase (menb) in complex with acetoacetyl coa (see paper)
63% identity, 95% coverage: 15:285/285 of query aligns to 1:260/260 of 2uzfA
- active site: G70 (= G86), R80 (≠ H105), L84 (= L109), G108 (= G133), V111 (= V136), T130 (= T155), G131 (= G156), S136 (= S161), D138 (= D163), A139 (≠ G164), A225 (= A250), Y233 (= Y258)
- binding acetoacetyl-coenzyme a: V28 (= V44), R29 (= R45), S68 (= S84), G69 (= G85), G70 (= G86), D71 (= D87), Y104 (= Y129), G108 (= G133)
4emlA Synechocystis sp. Pcc 6803 1,4-dihydroxy-2-naphthoyl-coenzyme a synthase (menb) in complex with bicarbonate (see paper)
63% identity, 96% coverage: 13:285/285 of query aligns to 1:261/261 of 4emlA
- active site: G77 (= G86), R81 (≠ H105), L85 (= L109), G109 (= G133), V112 (= V136), G132 (= G156), S137 (= S161), D139 (= D163), G140 (= G164), A226 (= A250), Y234 (= Y258)
- binding bicarbonate ion: G108 (= G132), Q130 (= Q154), G132 (= G156), W160 (= W184)
- binding chloride ion: D184 (≠ A208), R185 (≠ D209), E187 (= E211), E188 (≠ K212)
P9WNP5 1,4-dihydroxy-2-naphthoyl-CoA synthase; DHNA-CoA synthase; EC 4.1.3.36 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 4 papers)
48% identity, 94% coverage: 17:283/285 of query aligns to 29:312/314 of P9WNP5
- R58 (= R45) binding in other chain
- K95 (vs. gap) binding in other chain
- SGGDQ 103:107 (= SGGDQ 84:88) binding in other chain
- R133 (≠ H105) mutation to A: Loss of DHNA-CoA synthase activity.
- WAAGG 157:161 (≠ YSIGG 129:133) binding in other chain
- T184 (= T155) binding in other chain
- D185 (≠ G156) mutation to E: Nearly abolishes DHNA-CoA synthase activity.; mutation D->G,N: Loss of DHNA-CoA synthase activity.
- S190 (= S161) mutation to A: Reduces affinity for substrate. Nearly abolishes DHNA-CoA synthase activity.
- D192 (= D163) mutation to N: Loss of DHNA-CoA synthase activity.
- Y287 (= Y258) mutation to F: Loss of DHNA-CoA synthase activity.
4qijA Crystal structure of menb from mycobacteria tuberculosis in complex with 1-hna-coa (see paper)
48% identity, 94% coverage: 17:283/285 of query aligns to 16:299/301 of 4qijA
- active site: G92 (= G86), R97 (= R91), Y102 (= Y97), R117 (vs. gap), H122 (≠ N107), G148 (= G133), S151 (≠ V136), D172 (≠ G156), S177 (= S161), D179 (= D163), G180 (= G164), A266 (= A250), Y274 (= Y258)
- binding 1-hydroxy-2-naphthoyl-CoA: V44 (= V44), R45 (= R45), A47 (= A47), F48 (= F48), K82 (vs. gap), S90 (= S84), G91 (= G85), G92 (= G86), D93 (= D87), Q94 (= Q88), Y102 (= Y97), L121 (= L106), I123 (≠ V108), W144 (≠ Y129), G148 (= G133), T171 (= T155), D172 (≠ G156), S177 (= S161), F286 (= F270), K289 (= K273)
4qiiB Crystal structure of type ii menb from mycobacteria tuberculosis (see paper)
48% identity, 94% coverage: 17:283/285 of query aligns to 16:299/301 of 4qiiB
- active site: G92 (= G86), R97 (= R91), Y102 (= Y97), R117 (vs. gap), H122 (≠ N107), G148 (= G133), S151 (≠ V136), D172 (≠ G156), S177 (= S161), D179 (= D163), G180 (= G164), A266 (= A250), Y274 (= Y258)
- binding Salicylyl CoA: V44 (= V44), R45 (= R45), A47 (= A47), K82 (vs. gap), S90 (= S84), G92 (= G86), D93 (= D87), Q94 (= Q88), Y102 (= Y97), W144 (≠ Y129), G147 (= G132), G148 (= G133), T171 (= T155), D172 (≠ G156), V175 (= V159), S177 (= S161), Y274 (= Y258), F286 (= F270), K289 (= K273)
1q51B Crystal structure of mycobacterium tuberculosis menb in complex with acetoacetyl-coenzyme a, a key enzyme in vitamin k2 biosynthesis (see paper)
48% identity, 94% coverage: 17:283/285 of query aligns to 12:278/280 of 1q51B
- active site: G88 (= G86), H101 (≠ N107), G127 (= G133), S130 (≠ V136), D151 (≠ G156), S156 (= S161), D158 (= D163), G159 (= G164), A245 (= A250), Y253 (= Y258)
- binding acetoacetyl-coenzyme a: V40 (= V44), R41 (= R45), A43 (= A47), S86 (= S84), G88 (= G86), D89 (= D87), Q90 (= Q88), W123 (≠ Y129), G126 (= G132), G127 (= G133), T150 (= T155)
1q51A Crystal structure of mycobacterium tuberculosis menb in complex with acetoacetyl-coenzyme a, a key enzyme in vitamin k2 biosynthesis (see paper)
47% identity, 94% coverage: 17:283/285 of query aligns to 12:269/271 of 1q51A
- active site: G88 (= G86), H92 (≠ N107), G118 (= G133), S121 (≠ V136), D142 (≠ G156), S147 (= S161), D149 (= D163), G150 (= G164), A236 (= A250), Y244 (= Y258)
- binding acetoacetyl-coenzyme a: V40 (= V44), R41 (= R45), K78 (vs. gap), S86 (= S84), G88 (= G86), D89 (= D87), Q90 (= Q88), W114 (≠ Y129), G117 (= G132), G118 (= G133), T141 (= T155)
1rjnB The crystal structure of menb (rv0548c) from mycobacterium tuberculosis in complex with the coa portion of naphthoyl coa (see paper)
47% identity, 94% coverage: 17:283/285 of query aligns to 16:273/275 of 1rjnB
- active site: G92 (= G86), H96 (≠ N107), G122 (= G133), S125 (≠ V136), D146 (≠ G156), S151 (= S161), D153 (= D163), G154 (= G164), A240 (= A250)
- binding coenzyme a: V44 (= V44), R45 (= R45), K82 (vs. gap), S90 (= S84), G92 (= G86), D93 (= D87), Q94 (= Q88), W118 (≠ Y129)
- binding 3-[4-(2-hydroxyethyl)piperazin-1-yl]propane-1-sulfonic acid: R163 (= R173), Q164 (≠ I174), V165 (= V175), M188 (= M198)
3t8aB Crystal structure of mycobacterium tuberculosis menb in complex with substrate analogue, osb-ncoa (see paper)
47% identity, 94% coverage: 17:283/285 of query aligns to 15:272/274 of 3t8aB
- active site: G91 (= G86), H97 (≠ N107), G123 (= G133), S126 (≠ V136), D147 (≠ G156), S152 (= S161), D154 (= D163), G155 (= G164), A241 (= A250), Y249 (= Y258)
- binding o-succinylbenzoyl-N-coenzyme A: V43 (= V44), R44 (= R45), K81 (vs. gap), S89 (= S84), G91 (= G86), D92 (= D87), Q93 (= Q88), W119 (≠ Y129)
Query Sequence
>16369 FitnessBrowser__Keio:16369
MIYPDEAMLYAPVEWHDCSEGFEDIRYEKSTDGIAKITINRPQVRNAFRPLTVKEMIQAL
ADARYDDNIGVIILTGAGDKAFCSGGDQKVRGDYGGYKDDSGVHHLNVLDFQRQIRTCPK
PVVAMVAGYSIGGGHVLHMMCDLTIAADNAIFGQTGPKVGSFDGGWGASYMARIVGQKKA
REIWFLCRQYDAKQALDMGLVNTVVPLADLEKETVRWCREMLQNSPMALRCLKAALNADC
DGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQPDFSKFKRNP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory