SitesBLAST
Comparing 16391 FitnessBrowser__Keio:16391 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
100% identity, 99% coverage: 1:442/445 of query aligns to 1:442/442 of 7p61F
- binding flavin mononucleotide: G61 (= G61), G63 (= G63), K72 (= K72), N90 (= N90), D92 (= D92), G181 (= G181), E182 (= E182), N217 (= N217), N218 (= N218), A399 (= A399), H400 (= H400)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G63), G64 (= G64), A65 (= A65), F67 (= F67), K72 (= K72), L75 (= L75), E95 (= E95), Y178 (= Y178), E183 (= E183), F203 (= F203), R320 (= R320), T323 (= T323)
- binding iron/sulfur cluster: S350 (= S350), C351 (= C351), W353 (= W353), C354 (= C354), C357 (= C357), F397 (= F397), C398 (= C398), H400 (= H400)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
49% identity, 90% coverage: 21:421/445 of query aligns to 23:423/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
49% identity, 90% coverage: 21:421/445 of query aligns to 22:422/437 of 4hea1
- binding flavin mononucleotide: G63 (= G61), K74 (= K72), N91 (= N90), D93 (= D92), Y179 (= Y178), G182 (= G181), E183 (= E182), N218 (= N217), N219 (= N218), L401 (≠ H400)
- binding iron/sulfur cluster: I180 (= I179), P198 (= P197), S351 (= S350), C352 (= C351), G353 (= G352), K354 (≠ W353), C355 (= C354), C358 (= C357), F398 (= F397), C399 (= C398), L401 (≠ H400)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
49% identity, 90% coverage: 21:421/445 of query aligns to 22:422/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G61), G65 (= G63), N91 (= N90), D93 (= D92), G182 (= G181), E183 (= E182), E184 (= E183), N218 (= N217), N219 (= N218), T222 (= T221), P400 (≠ A399)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G63), G66 (= G64), F69 (= F67), K74 (= K72), F77 (≠ L75), E96 (= E95), Y179 (= Y178), E184 (= E183), K201 (= K200), F204 (= F203), T324 (= T323)
- binding iron/sulfur cluster: S351 (= S350), C352 (= C351), K354 (≠ W353), C355 (= C354), C358 (= C357), F398 (= F397), C399 (= C398), L401 (≠ H400), A402 (= A401)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
47% identity, 93% coverage: 7:421/445 of query aligns to 1:419/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G61), R54 (= R62), G55 (= G63), A57 (= A65), K64 (= K72), N90 (= N90), D92 (= D92), Y178 (= Y178), G181 (= G181), E182 (= E182), E183 (= E183), N217 (= N217), N218 (= N218), S221 (≠ T221), L398 (≠ H400)
- binding iron/sulfur cluster: P197 (= P197), S349 (= S350), C350 (= C351), G351 (= G352), K352 (≠ W353), C353 (= C354), C356 (= C357), S394 (≠ T396), F395 (= F397), C396 (= C398), L398 (≠ H400), G399 (≠ A401)
- binding zinc ion: C333 (≠ N334), E371 (= E372)
Sites not aligning to the query:
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
45% identity, 91% coverage: 22:425/445 of query aligns to 15:416/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ N334), C364 (≠ E372), H413 (≠ G422)
- binding flavin mononucleotide: G54 (= G61), G56 (= G63), K65 (= K72), N82 (= N90), D84 (= D92), E85 (= E93), G173 (= G181), E175 (= E183), N210 (= N218), G390 (≠ A399), L391 (≠ H400)
- binding nicotinamide-adenine-dinucleotide: G56 (= G63), G57 (= G64), A58 (= A65), F60 (= F67), K65 (= K72), F68 (≠ L75), E85 (= E93), E175 (= E183), R192 (≠ K200), F195 (= F203), I312 (≠ R320), M313 (≠ L321), S315 (≠ T323)
- binding iron/sulfur cluster: S342 (= S350), C343 (= C351), G344 (= G352), C346 (= C354), C349 (= C357), S387 (≠ T396), C389 (= C398), L391 (≠ H400), G392 (≠ A401)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
45% identity, 91% coverage: 22:425/445 of query aligns to 15:416/425 of 7t2rB
Sites not aligning to the query:
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
43% identity, 91% coverage: 22:425/445 of query aligns to 161:561/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G63), N227 (= N90), E230 (= E93), N355 (= N218), G535 (≠ A399), L536 (≠ H400)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E183), R337 (≠ K200), R340 (≠ F203), T341 (≠ P204), N342 (≠ A205), S433 (≠ G296)
- binding iron/sulfur cluster: S487 (= S350), C488 (= C351), G489 (= G352), C491 (= C354), C494 (= C357), C534 (= C398), L536 (≠ H400), G537 (≠ A401)
- binding zinc ion: C471 (≠ N334), H558 (≠ G422)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 564
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
45% identity, 89% coverage: 26:420/445 of query aligns to 30:414/419 of 6saqB
- binding flavin mononucleotide: G64 (= G61), G66 (= G63), K75 (= K72), N91 (= N90), D93 (= D92), E94 (= E93), Y179 (= Y178), G182 (= G181), E183 (= E182), N218 (= N217), N219 (= N218), T222 (= T221)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G63), G67 (= G64), A68 (= A65), F70 (= F67), K75 (= K72), E94 (= E93), E96 (= E95), T99 (= T98), E184 (= E183), Y204 (≠ F203), T318 (= T323)
- binding iron/sulfur cluster: P198 (= P197), T345 (≠ S350), C346 (= C351), G347 (= G352), Q348 (≠ W353), C349 (= C354), C352 (= C357), I391 (≠ F397), C392 (= C398), G395 (≠ A401)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
45% identity, 89% coverage: 26:420/445 of query aligns to 31:415/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G61), G67 (= G63), K76 (= K72), N92 (= N90), E95 (= E93), Y180 (= Y178), G183 (= G181), E184 (= E182), V218 (= V216), N219 (= N217), N220 (= N218), T223 (= T221)
- binding iron/sulfur cluster: T346 (≠ S350), C347 (= C351), G348 (= G352), Q349 (≠ W353), C350 (= C354), C353 (= C357), S391 (≠ T396), I392 (≠ F397), C393 (= C398), G396 (≠ A401)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
45% identity, 89% coverage: 26:420/445 of query aligns to 30:414/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G61), G66 (= G63), K75 (= K72), N91 (= N90), D93 (= D92), E94 (= E93), G182 (= G181), E183 (= E182), E184 (= E183), V217 (= V216), N218 (= N217), N219 (= N218), T222 (= T221), G393 (≠ A399)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G63), G67 (= G64), A68 (= A65), F70 (= F67), K75 (= K72), E94 (= E93), E96 (= E95), Y179 (= Y178), E184 (= E183), Y204 (≠ F203)
- binding iron/sulfur cluster: P198 (= P197), T345 (≠ S350), C346 (= C351), G347 (= G352), Q348 (≠ W353), C349 (= C354), C352 (= C357), I391 (≠ F397), C392 (= C398), L394 (≠ H400), G395 (≠ A401)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
45% identity, 89% coverage: 26:420/445 of query aligns to 29:413/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G61), G65 (= G63), K74 (= K72), N90 (= N90), D92 (= D92), E93 (= E93), G181 (= G181), E182 (= E182), E183 (= E183), V216 (= V216), N217 (= N217), N218 (= N218), T221 (= T221)
- binding nicotinamide-adenine-dinucleotide: G65 (= G63), G66 (= G64), A67 (= A65), F69 (= F67), K74 (= K72), E95 (= E95), Y178 (= Y178), E183 (= E183), K200 (= K200), Y203 (≠ F203)
- binding iron/sulfur cluster: I179 (= I179), P197 (= P197), T344 (≠ S350), C345 (= C351), G346 (= G352), Q347 (≠ W353), C348 (= C354), C351 (= C357), S389 (≠ T396), I390 (≠ F397), C391 (= C398), L393 (≠ H400), G394 (≠ A401)
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
43% identity, 90% coverage: 26:424/445 of query aligns to 150:546/613 of 7p8nB
- binding flavin mononucleotide: G185 (= G61), R186 (= R62), G187 (= G63), N213 (= N90), D215 (= D92), E216 (= E93), G217 (≠ M94), F301 (≠ Y178), G304 (= G181), E305 (= E182), E306 (= E183), N340 (= N217), N341 (= N218), G521 (≠ A399), L522 (≠ H400)
- binding iron/sulfur cluster: P320 (= P197), S473 (= S350), C474 (= C351), G475 (= G352), K476 (≠ W353), C477 (= C354), C480 (= C357), L519 (≠ F397), C520 (= C398), L522 (≠ H400), G523 (≠ A401)
- binding zinc ion: C457 (≠ N334), H544 (≠ G422)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 34, 36, 67, 68, 69, 70, 71
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 549, 554
7arcF Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
45% identity, 87% coverage: 40:425/445 of query aligns to 40:426/430 of 7arcF
- binding flavin mononucleotide: G61 (= G61), R62 (= R62), K72 (= K72), N90 (= N90), D92 (= D92), E93 (= E93), S94 (≠ M94), Y178 (= Y178), G181 (= G181), E182 (= E182), T217 (≠ N217), N218 (= N218), L401 (≠ H400)
- binding iron/sulfur cluster: S352 (= S350), C353 (= C351), G354 (= G352), Q355 (≠ W353), C356 (= C354), C359 (= C357), T397 (= T396), C399 (= C398), L401 (≠ H400)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
44% identity, 91% coverage: 22:425/445 of query aligns to 114:515/584 of 8oh5B
- binding flavin mononucleotide: R154 (= R62), K164 (= K72), N181 (= N90), F269 (≠ Y178), E273 (= E182), E274 (= E183), I307 (≠ V216), N308 (= N217), N309 (= N218), G489 (≠ A399), L490 (≠ H400)
- binding nicotinamide-adenine-dinucleotide: G155 (= G63), G156 (= G64), F159 (= F67), F163 (≠ L71), E273 (= E182), E274 (= E183), K291 (= K200), F294 (= F203), G413 (= G322)
- binding iron/sulfur cluster: P288 (= P197), C442 (= C351), G443 (= G352), C445 (= C354), C448 (= C357), C488 (= C398), L490 (≠ H400), G491 (≠ A401)
- binding zinc ion: C425 (≠ N334), H512 (≠ G422)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 10, 41, 45
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 518, 523
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
44% identity, 87% coverage: 47:431/445 of query aligns to 42:426/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G63), K67 (= K72), N85 (= N90), D87 (= D92), E88 (= E93), G89 (≠ M94), C175 (= C180), G176 (= G181), A212 (≠ N217), N213 (= N218)
- binding iron/sulfur cluster: S347 (= S350), C348 (= C351), G349 (= G352), C351 (= C354), C354 (= C357), C394 (= C398), L396 (≠ H400)
- binding : R121 (≠ Y126), Y132 (≠ I137), Q139 (≠ R144), R143 (≠ A148), Y146 (≠ T151), E147 (= E152), F165 (= F170), R168 (≠ T173)
5lnk1 Entire ovine respiratory complex i (see paper)
44% identity, 87% coverage: 47:431/445 of query aligns to 47:431/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P96), G97 (= G97)
- binding flavin mononucleotide: G61 (= G61), R62 (= R62), K72 (= K72), N90 (= N90), D92 (= D92), E93 (= E93), G94 (≠ M94), Y178 (= Y178), G181 (= G181), E182 (= E182), V216 (= V216), A217 (≠ N217), N218 (= N218), T221 (= T221), L401 (≠ H400)
- binding iron/sulfur cluster: P197 (= P197), S352 (= S350), C353 (= C351), Q355 (≠ W353), C356 (= C354), C359 (= C357), T397 (= T396), I398 (≠ F397), C399 (= C398)
6zk91 Peripheral domain of open complex i during turnover (see paper)
44% identity, 87% coverage: 47:431/445 of query aligns to 45:429/430 of 6zk91
- binding flavin mononucleotide: G59 (= G61), G61 (= G63), K70 (= K72), N88 (= N90), D90 (= D92), E91 (= E93), G179 (= G181), E180 (= E182), A215 (≠ N217), N216 (= N218), A398 (= A399), L399 (≠ H400)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G63), G62 (= G64), A63 (= A65), F65 (= F67), K70 (= K72), E93 (= E95), Y176 (= Y178), E181 (= E183), F201 (= F203), T323 (= T323)
- binding iron/sulfur cluster: I177 (= I179), P195 (= P197), C351 (= C351), G352 (= G352), Q353 (≠ W353), C354 (= C354), C357 (= C357), T395 (= T396), C397 (= C398), L399 (≠ H400)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
43% identity, 91% coverage: 22:425/445 of query aligns to 127:530/599 of 7q4vB
- binding flavin mononucleotide: G166 (= G61), G168 (= G63), N196 (= N90), D198 (= D92), F284 (≠ Y178), G287 (= G181), E288 (= E182), E289 (= E183), N324 (= N218)
- binding iron/sulfur cluster: C457 (= C351), G458 (= G352), K459 (≠ W353), C460 (= C354), C463 (= C357), C503 (= C398), G506 (≠ A401)
- binding zinc ion: C440 (≠ N334), H527 (≠ G422)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16, 48, 49, 51, 52
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 533
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
43% identity, 90% coverage: 26:425/445 of query aligns to 2:401/470 of 7q4vF
- binding flavin mononucleotide: G37 (= G61), G39 (= G63), N67 (= N90), G158 (= G181), E159 (= E182), E160 (= E183), G375 (≠ A399)
- binding nicotinamide-adenine-dinucleotide: G40 (= G64), F43 (= F67), K48 (= K72), R177 (≠ K200), F180 (= F203), M297 (≠ R320)
- binding iron/sulfur cluster: S327 (= S350), C328 (= C351), G329 (= G352), K330 (≠ W353), C331 (= C354), C334 (= C357), L373 (≠ F397), C374 (= C398)
- binding zinc ion: C311 (≠ N334), H398 (≠ G422)
Sites not aligning to the query:
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 404, 409
Query Sequence
>16391 FitnessBrowser__Keio:16391
MKNIIRTPETHPLTWRLRDDKQPVWLDEYRSKNGYEGARKALTGLSPDEIVNQVKDAGLK
GRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRLLMEQLPHLLVEGMLISA
FALKAYRGYIFLRGEYIEAAVNLRRAIAEATEAGLLGKNIMGTGFDFELFVHTGAGRYIC
GEETALINSLEGRRANPRSKPPFPATSGAWGKPTCVNNVETLCNVPAILANGVEWYQNIS
KSKDAGTKLMGFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGAGTDFL
TEAHLDLPMEFESIGKAGSRLGTALAMAVDHEINMVSLVRNLEEFFARESCGWCTPCRDG
LPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAHAPGAVEPLQSAIKYFREEFE
AGIKQPFSNTHLINGIQPNLLKERW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory