Comparing 16397 FitnessBrowser__Keio:16397 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A959 Glutamate-pyruvate aminotransferase AlaA; EC 2.6.1.2 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:405/405 of query aligns to 1:405/405 of P0A959
4cvqA Crystal structure of an aminotransferase from escherichia coli at 2. 11 angstroem resolution (see paper)
100% identity, 100% coverage: 1:404/405 of query aligns to 1:404/404 of 4cvqA
1xi9C Alanine aminotransferase from pyrococcus furiosus pfu-1397077-001
40% identity, 97% coverage: 7:400/405 of query aligns to 3:391/393 of 1xi9C
Q93703 Tyrosine aminotransferase; TAT; L-tyrosine:2-oxoglutarate aminotransferase; EC 2.6.1.5 from Caenorhabditis elegans (see 3 papers)
29% identity, 90% coverage: 34:398/405 of query aligns to 75:437/464 of Q93703
3tcmA Crystal structure of alanine aminotransferase from hordeum vulgare (see paper)
28% identity, 96% coverage: 15:402/405 of query aligns to 17:474/479 of 3tcmA
1j32A Aspartate aminotransferase from phormidium lapideum
29% identity, 98% coverage: 7:401/405 of query aligns to 4:386/388 of 1j32A
1o4sB Crystal structure of aspartate aminotransferase (tm1255) from thermotoga maritima at 1.90 a resolution (see paper)
29% identity, 86% coverage: 24:372/405 of query aligns to 28:357/384 of 1o4sB
1gdeA Crystal structure of pyrococcus protein a-1 e-form (see paper)
30% identity, 90% coverage: 35:399/405 of query aligns to 27:382/388 of 1gdeA
1gd9A Crystall structure of pyrococcus protein-a1 (see paper)
30% identity, 90% coverage: 35:399/405 of query aligns to 27:382/388 of 1gd9A
5wmhA Arabidopsis thaliana prephenate aminotransferase (see paper)
32% identity, 85% coverage: 25:370/405 of query aligns to 21:369/399 of 5wmhA
5wmlA Arabidopsis thaliana prephenate aminotransferase mutant- k306a (see paper)
32% identity, 85% coverage: 25:370/405 of query aligns to 22:370/404 of 5wmlA
Sites not aligning to the query:
5wmiA Arabidopsis thaliana prephenate aminotransferase mutant- t84v (see paper)
32% identity, 84% coverage: 32:370/405 of query aligns to 28:369/402 of 5wmiA
Sites not aligning to the query:
1gc4A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with aspartate (see paper)
29% identity, 97% coverage: 7:399/405 of query aligns to 5:382/382 of 1gc4A
1gc3A Thermus thermophilus aspartate aminotransferase tetra mutant 2 complexed with tryptophan (see paper)
29% identity, 97% coverage: 7:399/405 of query aligns to 5:382/382 of 1gc3A
6f77A Crystal structure of the prephenate aminotransferase from rhizobium meliloti (see paper)
28% identity, 94% coverage: 21:400/405 of query aligns to 18:396/399 of 6f77A
Q02635 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.79 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
28% identity, 94% coverage: 21:400/405 of query aligns to 19:397/400 of Q02635
Sites not aligning to the query:
1b5oA Thermus thermophilus aspartate aminotransferase single mutant 1 (see paper)
30% identity, 93% coverage: 24:399/405 of query aligns to 22:382/382 of 1b5oA
1bkgA Aspartate aminotransferase from thermus thermophilus with maleate (see paper)
29% identity, 93% coverage: 24:399/405 of query aligns to 22:382/382 of 1bkgA
1bjwA Aspartate aminotransferase from thermus thermophilus (see paper)
29% identity, 93% coverage: 24:399/405 of query aligns to 22:382/382 of 1bjwA
Q56232 Aspartate/prephenate aminotransferase; AspAT / PAT; Transaminase A; EC 2.6.1.1; EC 2.6.1.78 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see 3 papers)
29% identity, 93% coverage: 24:399/405 of query aligns to 22:382/385 of Q56232
Sites not aligning to the query:
>16397 FitnessBrowser__Keio:16397
MSPIEKSSKLENVCYDIRGPVLKEAKRLEEEGNKVLKLNIGNPAPFGFDAPDEILVDVIR
NLPTAQGYCDSKGLYSARKAIMQHYQARGMRDVTVEDIYIGNGVSELIVQAMQALLNSGD
EMLVPAPDYPLWTAAVSLSSGKAVHYLCDESSDWFPDLDDIRAKITPRTRGIVIINPNNP
TGAVYSKELLMEIVEIARQHNLIIFADEIYDKILYDDAEHHSIAPLAPDLLTITFNGLSK
TYRVAGFRQGWMVLNGPKKHAKGYIEGLEMLASMRLCANVPAQHAIQTALGGYQSISEFI
TPGGRLYEQRNRAWELINDIPGVSCVKPRGALYMFPKIDAKRFNIHDDQKMVLDFLLQEK
VLLVQGTAFNWPWPDHFRIVTLPRVDDIELSLSKFARFLSGYHQL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory