SitesBLAST
Comparing 16427 FitnessBrowser__Keio:16427 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3oetH D-erythronate-4-phosphate dehydrogenase complexed with NAD
89% identity, 99% coverage: 1:376/378 of query aligns to 3:378/378 of 3oetH
- active site: N93 (= N91), R210 (= R208), D234 (= D232), E237 (= E235), E239 (= E237), G253 (= G251), H256 (= H254)
- binding nicotinamide-adenine-dinucleotide: N93 (= N91), V97 (= V95), G125 (= G123), G127 (= G125), N128 (= N126), V129 (= V127), D148 (= D146), P149 (= P147), P150 (= P148), H176 (= H174), T177 (= T175), P178 (= P176), Y185 (= Y183), T187 (= T185), A208 (= A206), C209 (= C207), H256 (= H254), A258 (= A256)
5dt9A Crystal structure of a putative d-erythronate-4-phosphate dehydrogenase from vibrio cholerae
50% identity, 98% coverage: 1:371/378 of query aligns to 4:375/379 of 5dt9A
- active site: N95 (= N91), R212 (= R208), D236 (= D232), E241 (= E237), H258 (= H254)
- binding nicotinamide-adenine-dinucleotide: N95 (= N91), G129 (= G125), Q130 (≠ N126), V131 (= V127), D150 (= D146), K153 (≠ R149), H178 (= H174), T179 (= T175), P180 (= P176), W187 (≠ Y183), T189 (= T185), A210 (= A206), A211 (≠ C207), H258 (= H254), A260 (= A256), G261 (= G257)
2o4cA Crystal structure of d-erythronate-4-phosphate dehydrogenase complexed with NAD (see paper)
48% identity, 94% coverage: 1:354/378 of query aligns to 1:360/380 of 2o4cA
- active site: N91 (= N91), R208 (= R208), D232 (= D232), E237 (= E237), H254 (= H254)
- binding nicotinamide-adenine-dinucleotide: N91 (= N91), V95 (= V95), G123 (= G123), G125 (= G125), Q126 (≠ N126), V127 (= V127), D146 (= D146), P147 (= P147), P148 (= P148), H174 (= H174), T175 (= T175), P176 (= P176), H183 (≠ Y183), T185 (= T185), A206 (= A206), S207 (≠ C207), H254 (= H254), A256 (= A256), G257 (= G257)
- binding phosphate ion: T66 (= T66), R346 (= R340)
Q9I3W9 Erythronate-4-phosphate dehydrogenase; EC 1.1.1.290 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
48% identity, 94% coverage: 1:354/378 of query aligns to 1:360/380 of Q9I3W9
- C65 (≠ A65) modified: Disulfide link with 90
- C90 (= C90) modified: Disulfide link with 65
- QV 126:127 (≠ NV 126:127) binding
- D146 (= D146) binding
- T175 (= T175) binding
- ASR 206:208 (≠ ACR 206:208) binding
- D232 (= D232) binding
- G257 (= G257) binding
3kb6B Crystal structure of d-lactate dehydrogenase from aquifex aeolicus complexed with NAD and lactic acid (see paper)
30% identity, 71% coverage: 7:276/378 of query aligns to 11:319/334 of 3kb6B
- active site: S97 (≠ N91), R231 (= R208), D255 (= D232), E260 (= E237), H294 (= H254)
- binding lactic acid: F49 (≠ R44), S72 (≠ T66), V73 (≠ A67), G74 (= G68), Y96 (≠ C90), R231 (= R208), H294 (= H254)
- binding nicotinamide-adenine-dinucleotide: V73 (≠ A67), Y96 (≠ C90), V101 (= V95), G150 (= G125), R151 (≠ N126), I152 (≠ V127), D171 (= D146), V172 (≠ P147), P203 (= P176), T229 (≠ A206), A230 (≠ C207), R231 (= R208), H294 (= H254), A296 (= A256), Y297 (≠ G257)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
31% identity, 65% coverage: 32:278/378 of query aligns to 36:302/304 of 1wwkA
- active site: S96 (≠ N91), R230 (= R208), D254 (= D232), E259 (= E237), H278 (= H254)
- binding nicotinamide-adenine-dinucleotide: V100 (= V95), G146 (vs. gap), F147 (vs. gap), G148 (vs. gap), R149 (vs. gap), I150 (vs. gap), Y168 (≠ C145), D169 (= D146), P170 (= P147), V201 (≠ T175), P202 (= P176), T207 (= T185), T228 (≠ A206), S229 (≠ C207), D254 (= D232), H278 (= H254), G280 (≠ A256)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
27% identity, 61% coverage: 34:263/378 of query aligns to 42:297/334 of 5aovA
- active site: L100 (≠ N91), R241 (= R208), D265 (= D232), E270 (= E237), H288 (= H254)
- binding glyoxylic acid: M52 (≠ R44), L53 (≠ S45), L53 (≠ S45), Y74 (≠ A65), A75 (≠ T66), V76 (≠ A67), G77 (= G68), R241 (= R208), H288 (= H254)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A67), T104 (≠ V95), F158 (≠ V124), G159 (= G125), R160 (≠ N126), I161 (≠ V127), S180 (≠ D146), R181 (≠ P147), A211 (≠ H174), V212 (≠ T175), P213 (= P176), T218 (= T185), I239 (≠ A206), A240 (≠ C207), R241 (= R208), H288 (= H254), G290 (≠ A256)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
30% identity, 62% coverage: 32:265/378 of query aligns to 34:286/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G125), I148 (≠ V127), Y166 (≠ C145), D167 (= D146), P168 (= P147), I169 (vs. gap), I170 (vs. gap), H198 (= H174), T199 (= T175), L208 (= L188), R228 (= R208)
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
30% identity, 62% coverage: 32:265/378 of query aligns to 36:288/297 of 6rj3A
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
30% identity, 62% coverage: 32:265/378 of query aligns to 36:288/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N91), A100 (≠ V95), R149 (≠ N126), I150 (≠ V127), Y168 (≠ C145), D169 (= D146), P170 (= P147), I171 (vs. gap), H200 (= H174), T201 (= T175), P202 (= P176), T207 (= T185), C228 (≠ A206), A229 (≠ C207), R230 (= R208), H277 (= H254), G279 (≠ A256)
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
30% identity, 62% coverage: 32:265/378 of query aligns to 37:289/301 of 6rj5A
7dkmA Phgdh covalently linked to oridonin (see paper)
29% identity, 66% coverage: 32:281/378 of query aligns to 38:306/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ A67), A102 (≠ V95), G148 (= G123), R151 (≠ N126), I152 (≠ V127), Y170 (≠ C145), D171 (= D146), P172 (= P147), I173 (vs. gap), H202 (= H174), T203 (= T175), P204 (= P176), T209 (= T185), C230 (≠ A206), A231 (≠ C207), R232 (= R208), H279 (= H254), G281 (≠ A256)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: E293 (≠ T268)
Sites not aligning to the query:
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: 14, 17, 18
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
30% identity, 62% coverage: 32:265/378 of query aligns to 42:294/533 of O43175
- T78 (≠ A67) binding
- R135 (= R109) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ NV 126:127) binding
- D175 (= D146) binding
- T207 (= T175) binding
- CAR 234:236 (≠ ACR 206:208) binding
- D260 (= D232) binding
- V261 (= V233) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HIAG 254:257) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
30% identity, 62% coverage: 32:265/378 of query aligns to 37:289/303 of 6plgA
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
30% identity, 62% coverage: 32:265/378 of query aligns to 37:289/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V122), G147 (= G123), L148 (≠ V124), G149 (= G125), R150 (≠ N126), I151 (≠ V127), G152 (= G128), D170 (= D146), H201 (= H174), T202 (= T175), P203 (= P176)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
30% identity, 62% coverage: 32:265/378 of query aligns to 37:289/302 of 6rihA
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
30% identity, 62% coverage: 32:265/378 of query aligns to 38:290/305 of 6plfA
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
28% identity, 70% coverage: 2:265/378 of query aligns to 2:280/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ N126), Y160 (≠ C145), D161 (= D146), P162 (= P147), I164 (vs. gap), L179 (= L161), T193 (= T175), P194 (= P176), S198 (≠ K184), L202 (= L188)
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
32% identity, 66% coverage: 26:273/378 of query aligns to 30:296/526 of 3dc2A
Sites not aligning to the query:
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
32% identity, 66% coverage: 26:273/378 of query aligns to 31:297/525 of 3ddnB
Query Sequence
>16427 FitnessBrowser__Keio:16427
MKILVDENMPYARDLFSRLGEVTAVPGRPIPVAQLADADALMVRSVTKVNESLLAGKPIK
FVGTATAGTDHVDEAWLKQAGIGFSAAPGCNAIAVVEYVFSSLLMLAERDGFSLYDRTVG
IVGVGNVGRRLQARLEALGIKTLLCDPPRADRGDEGDFRSLDELVQRADILTFHTPLFKD
GPYKTLHLADEKLIRSLKPGAILINACRGAVVDNTALLTCLNEGQKLSVVLDVWEGEPEL
NVELLKKVDIGTSHIAGYTLEGKARGTTQVFEAYSKFIGHEQHVALDTLLPAPEFGRITL
HGPLDQPTLKRLVHLVYDVRRDDAPLRKVAGIPGEFDKLRKNYLERREWSSLYVICDDAS
AASLLCKLGFNAVHHPAR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory