SitesBLAST
Comparing 16448 FitnessBrowser__Keio:16448 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6bn2A Crystal structure of acetyl-coa acetyltransferase from elizabethkingia anophelis nuhp1
33% identity, 97% coverage: 14:434/436 of query aligns to 3:390/393 of 6bn2A
2wkuA Biosynthetic thiolase from z. Ramigera. The n316h mutant. (see paper)
35% identity, 97% coverage: 15:435/436 of query aligns to 2:388/389 of 2wkuA
- active site: C86 (= C99), H345 (= H392), C375 (= C422), G377 (≠ A424)
- binding D-mannose: S6 (= S19), A7 (≠ G20), R38 (= R51), K182 (≠ R212), D194 (≠ E224), V280 (≠ I309), D281 (= D310), T287 (≠ L317), P331 (≠ D378), S332 (= S379), V334 (≠ F381), V336 (= V383), F360 (≠ H407)
1ou6A Biosynthetic thiolase from zoogloea ramigera in complex with acetyl-o- pantetheine-11-pivalate
35% identity, 97% coverage: 15:435/436 of query aligns to 5:391/392 of 1ou6A
- active site: C89 (= C99), H348 (= H392), C378 (= C422), G380 (≠ A424)
- binding pantothenyl-aminoethanol-acetate pivalic acid: L148 (≠ V175), H156 (≠ R183), M157 (= M184), F235 (= F260), A243 (= A269), S247 (≠ T273), A318 (= A345), F319 (= F346), H348 (= H392)
2vu2A Biosynthetic thiolase from z. Ramigera. Complex with s-pantetheine-11- pivalate. (see paper)
35% identity, 97% coverage: 15:435/436 of query aligns to 2:388/389 of 2vu2A
- active site: C86 (= C99), H345 (= H392), C375 (= C422), G377 (≠ A424)
- binding (3R)-3-hydroxy-2,2-dimethyl-4-oxo-4-({3-oxo-3-[(2-sulfanylethyl)amino]propyl}amino)butyl 2,2-dimethylpropanoate: H153 (≠ R183), M154 (= M184), F232 (= F260), S244 (≠ T273), G245 (≠ P274), F316 (= F346), H345 (= H392)
1dm3A Acetylated biosynthetic thiolase from zoogloea ramigera in complex with acetyl-coa (see paper)
35% identity, 97% coverage: 15:435/436 of query aligns to 2:388/389 of 1dm3A
- active site: C86 (= C99), H345 (= H392), C375 (= C422), G377 (≠ A424)
- binding acetyl coenzyme *a: C86 (= C99), L145 (≠ V175), H153 (≠ R183), M154 (= M184), R217 (= R245), S224 (≠ D252), M225 (≠ Y253), A240 (= A269), S244 (≠ T273), M285 (= M315), A315 (= A345), F316 (= F346), H345 (= H392), C375 (= C422)
1dlvA Biosynthetic thiolase from zoogloea ramigera in complex with coa (see paper)
35% identity, 97% coverage: 15:435/436 of query aligns to 2:388/389 of 1dlvA
- active site: C86 (= C99), H345 (= H392), C375 (= C422), G377 (≠ A424)
- binding coenzyme a: C86 (= C99), L145 (≠ V175), H153 (≠ R183), M154 (= M184), R217 (= R245), L228 (= L256), A240 (= A269), S244 (≠ T273), H345 (= H392)
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
35% identity, 97% coverage: 15:435/436 of query aligns to 4:390/391 of 2vu1A
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
34% identity, 96% coverage: 17:435/436 of query aligns to 7:391/392 of P07097
- Q64 (≠ P74) mutation to A: Slightly lower activity.
- C89 (= C99) mutation to A: Loss of activity.
- C378 (= C422) mutation to G: Loss of activity.
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
36% identity, 96% coverage: 15:434/436 of query aligns to 4:391/393 of P14611
- C88 (= C99) active site, Acyl-thioester intermediate; mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
- H156 (≠ R183) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- F219 (≠ N243) mutation to A: About 50% loss of acetoacetyl-CoA thiolase activity.; mutation to Y: 2-fold increase of acetoacetyl-CoA thiolase activity.
- R221 (= R245) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- S248 (≠ T273) mutation to A: About 40% loss of acetoacetyl-CoA thiolase activity.
- H349 (= H392) mutation to A: Almost complete loss of acetoacetyl-CoA thiolase activity.
- C379 (= C422) mutation to S: Almost complete loss of acetoacetyl-CoA thiolase activity.
1m1oA Crystal structure of biosynthetic thiolase, c89a mutant, complexed with acetoacetyl-coa (see paper)
34% identity, 97% coverage: 15:435/436 of query aligns to 3:389/390 of 1m1oA
- active site: A87 (≠ C99), H346 (= H392), C376 (= C422), G378 (≠ A424)
- binding acetoacetyl-coenzyme a: L86 (≠ A98), A87 (≠ C99), L146 (≠ V175), H154 (≠ R183), M155 (= M184), R218 (= R245), S225 (≠ D252), M226 (≠ Y253), A241 (= A269), G242 (≠ A270), S245 (≠ T273), A316 (= A345), F317 (= F346), H346 (= H392), I377 (≠ A423), G378 (≠ A424)
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
36% identity, 96% coverage: 15:434/436 of query aligns to 4:391/393 of 4o9cC
- active site: S88 (≠ C99), H349 (= H392), C379 (= C422), G381 (≠ A424)
- binding coenzyme a: S88 (≠ C99), L148 (≠ A174), R221 (= R245), F236 (= F260), A244 (= A269), S248 (≠ T273), L250 (= L275), A319 (= A345), F320 (= F346), H349 (= H392)
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
33% identity, 97% coverage: 14:434/436 of query aligns to 3:390/392 of P45359
- V77 (= V88) mutation to Q: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Y-153 and K-286.
- C88 (= C99) modified: Disulfide link with 378, In inhibited form
- S96 (≠ A107) binding
- N153 (≠ T180) mutation to Y: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and K-286.
- GS 279:280 (≠ AF 305:306) binding
- A286 (≠ Q313) mutation to K: 3-fold increase in thiolase activity, prevents disulfide bond formation under oxidized condition and results in the loss of regulatory mechanism based on redox-switch modulation; when associated with Q-77 and Y-153.
- C378 (= C422) modified: Disulfide link with 88, In inhibited form
- A386 (= A430) binding
2ib8D Crystallographic and kinetic studies of human mitochondrial acetoacetyl-coa thiolase (t2): the importance of potassium and chloride for its structure and function (see paper)
30% identity, 97% coverage: 14:434/436 of query aligns to 7:391/393 of 2ib8D
2f2sA Human mitochondrial acetoacetyl-coa thiolase
30% identity, 98% coverage: 7:434/436 of query aligns to 4:387/389 of 2f2sA
- active site: C95 (= C99), H347 (= H392), C375 (= C422), G377 (≠ A424)
- binding coenzyme a: C95 (= C99), L153 (≠ V175), H161 (≠ R183), M162 (= M184), Y188 (≠ H210), R220 (≠ N247), V221 (≠ S248), D222 (≠ S249), K225 (≠ D252), L229 (= L256), F233 (= F260), A242 (= A269), S246 (≠ T273), A317 (= A345), F318 (= F346), H347 (= H392)
P24752 Acetyl-CoA acetyltransferase, mitochondrial; Acetoacetyl-CoA thiolase; T2; EC 2.3.1.9 from Homo sapiens (Human) (see 6 papers)
30% identity, 97% coverage: 14:434/436 of query aligns to 41:425/427 of P24752
- N93 (≠ Q66) to S: in 3KTD; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074145
- N158 (≠ V131) to D: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs148639841
- G183 (≠ A174) to R: in 3KTD; no activity; dbSNP:rs120074141
- Y219 (≠ H210) binding ; binding
- RVD 258:260 (≠ NSS 247:249) binding
- K263 (≠ D252) binding
- A280 (= A269) binding
- A281 (= A270) binding
- A283 (≠ S272) binding
- S284 (≠ T273) binding
- T297 (= T286) to M: in 3KTD; decreased protein abundance; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs886041122
- A301 (= A290) to P: in 3KTD; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs1420321267
- I312 (≠ L301) to T: in 3KTD; decreased protein stability; decreased acetyl-CoA C-acyltransferase activity; less than 10% of the degradative/thiolase activity; dbSNP:rs120074146
- A333 (≠ T323) to P: in 3KTD; loss of protein solubility; loss of acetyl-CoA C-acyltransferase activity; no degradative/thiolase activity; dbSNP:rs120074147
- A380 (≠ S387) to T: in 3KTD; decreased protein stability; dbSNP:rs120074140
- V381 (≠ I388) binding
Sites not aligning to the query:
- 5 A → P: in dbSNP:rs3741056
7cw5B Acetyl-coa acetyltransferase from bacillus cereus atcc 14579 (see paper)
32% identity, 97% coverage: 14:434/436 of query aligns to 2:390/394 of 7cw5B
- active site: C87 (= C99), H348 (= H392), C378 (= C422), G380 (≠ A424)
- binding coenzyme a: L147 (≠ A174), H155 (≠ R183), M156 (= M184), R220 (= R245), T223 (≠ S248), A243 (= A269), P247 (≠ T273), L249 (= L275), H348 (= H392)
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
36% identity, 96% coverage: 17:434/436 of query aligns to 8:393/394 of 5f38D
- active site: C90 (= C99), A348 (= A389), A378 (≠ V419), L380 (≠ A421)
- binding [(3~{S})-2,2-dimethyl-3-oxidanyl-4-oxidanylidene-4-[[3-oxidanylidene-3-(2-sulfanylethylamino)propyl]amino]butyl] phosphono hydrogen phosphate: C90 (= C99), L151 (≠ M169), A246 (= A269), S250 (≠ T273), I252 (≠ L275), A321 (= A345), F322 (= F346), H351 (= H392)
5f38B X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
35% identity, 96% coverage: 17:434/436 of query aligns to 6:389/391 of 5f38B
- active site: C88 (= C99), H347 (= H392), C377 (= C422), G379 (≠ A424)
- binding coenzyme a: C88 (= C99), L149 (≠ M169), K219 (≠ R245), F234 (= F260), A242 (= A269), S246 (≠ T273), A317 (= A345), F318 (= F346), H347 (= H392)
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
33% identity, 97% coverage: 14:434/436 of query aligns to 3:390/392 of 4xl4A
- active site: C88 (= C99), H348 (= H392), S378 (≠ C422), G380 (≠ A424)
- binding coenzyme a: L148 (≠ V175), H156 (≠ R183), R220 (= R245), L231 (= L256), A243 (= A269), S247 (≠ T273), F319 (= F346), H348 (= H392)
5bz4K Crystal structure of a t1-like thiolase (coa-complex) from mycobacterium smegmatis (see paper)
35% identity, 96% coverage: 17:434/436 of query aligns to 5:396/400 of 5bz4K
- active site: C87 (= C99), H354 (= H392), C384 (= C422), G386 (≠ A424)
- binding coenzyme a: C87 (= C99), R146 (= R164), M160 (≠ V175), R220 (= R245), A246 (= A269), G247 (≠ A270), S250 (≠ T273), Q252 (≠ L275), M291 (≠ L316), A321 (= A345), F322 (= F346), H354 (= H392)
Query Sequence
>16448 FitnessBrowser__Keio:16448
MGQVLPLVTRQGDRIAIVSGLRTPFARQATAFHGIPAVDLGKMVVGELLARSEIPAEVIE
QLVFGQVVQMPEAPNIAREIVLGTGMNVHTDAYSVSRACATSFQAVANVAESLMAGTIRA
GIAGGADSSSVLPIGVSKKLARVLVDVNKARTMSQRLKLFSRLRLRDLMPVPPAVAEYST
GLRMGDTAEQMAKTYGITREQQDALAHRSHQRAAQAWSDGKLKEEVMTAFIPPYKQPLVE
DNNIRGNSSLADYAKLRPAFDRKHGTVTAANSTPLTDGAAAVILMTESRAKELGLVPLGY
LRSYAFTAIDVWQDMLLGPAWSTPLALERAGLTMSDLTLIDMHEAFAAQTLANIQLLGSE
RFAREALGRAHATGEVDDSKFNVLGGSIAYGHPFAATGARMITQTLHELRRRGGGFGLVT
ACAAGGLGAAMVLEAE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory