Comparing 16498 FitnessBrowser__Keio:16498 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
5l26A Structure of cntnw in an inward-facing substrate-bound state (see paper)
31% identity, 99% coverage: 4:398/400 of query aligns to 5:411/419 of 5l26A
5l2aA Structure of cntnw n149s,f366a in an outward-facing state (see paper)
31% identity, 99% coverage: 4:398/400 of query aligns to 6:417/422 of 5l2aA
4pd7A Structure of vccnt bound to zebularine (see paper)
29% identity, 98% coverage: 8:400/400 of query aligns to 6:404/404 of 4pd7A
3tijA Crystal structure of a concentrative nucleoside transporter from vibrio cholerae (see paper)
29% identity, 98% coverage: 8:400/400 of query aligns to 6:404/404 of 3tijA
4pd5A Crystal structure of vccnt-7c8c bound to gemcitabine (see paper)
29% identity, 98% coverage: 8:400/400 of query aligns to 5:403/403 of 4pd5A
4pdaA Structure of vccnt-7c8c bound to cytidine (see paper)
29% identity, 98% coverage: 8:400/400 of query aligns to 6:404/404 of 4pdaA
4pd9A Structure of vccnt-7c8c bound to adenosine (see paper)
29% identity, 98% coverage: 8:400/400 of query aligns to 6:404/404 of 4pd9A
4pd8A Structure of vccnt-7c8c bound to pyrrolo-cytidine (see paper)
29% identity, 98% coverage: 8:400/400 of query aligns to 6:404/404 of 4pd8A
4pb2A Structure of vccnt-7c8c bound to 5-fluorouridine (see paper)
29% identity, 98% coverage: 8:400/400 of query aligns to 6:404/404 of 4pb2A
4pb1A Structure of vccnt-7c8c bound to ribavirin (see paper)
29% identity, 98% coverage: 8:400/400 of query aligns to 6:404/404 of 4pb1A
O00337 Sodium/nucleoside cotransporter 1; Concentrative nucleoside transporter 1; CNT 1; hCNT1; Na(+)/nucleoside cotransporter 1; Sodium-coupled nucleoside transporter 1; Solute carrier family 28 member 1 from Homo sapiens (Human) (see 7 papers)
26% identity, 93% coverage: 30:399/400 of query aligns to 213:590/649 of O00337
Sites not aligning to the query:
Q9HAS3 Solute carrier family 28 member 3; Concentrative Na(+)-nucleoside cotransporter 3; CNT 3; hCNT3 from Homo sapiens (Human) (see 5 papers)
24% identity, 88% coverage: 49:399/400 of query aligns to 245:612/691 of Q9HAS3
Sites not aligning to the query:
Q62674 Sodium/nucleoside cotransporter 1; Concentrative nucleoside transporter 1; CNT 1; Na(+)/nucleoside cotransporter 1; Sodium-coupled nucleoside transporter 1; Solute carrier family 28 member 1 from Rattus norvegicus (Rat) (see paper)
24% identity, 95% coverage: 22:399/400 of query aligns to 196:590/648 of Q62674
Sites not aligning to the query:
>16498 FitnessBrowser__Keio:16498
MDRVLHFVLALAVVAILALLVSSDRKKIRIRYVIQLLVIEVLLAWFFLNSDVGLGFVKGF
SEMFEKLLGFANEGTNFVFGSMNDQGLAFFFLKVLCPIVFISALIGILQHIRVLPVIIRA
IGFLLSKVNGMGKLESFNAVSSLILGQSENFIAYKDILGKISRNRMYTMAATAMSTVSMS
IVGAYMTMLEPKYVVAALVLNMFSTFIVLSLINPYRVDASEENIQMSNLHEGQSFFEMLG
EYILAGFKVAIIVAAMLIGFIALIAALNALFATVTGWFGYSISFQGILGYIFYPIAWVMG
VPSSEALQVGSIMATKLVSNEFVAMMDLQKIASTLSPRAEGIISVFLVSFANFSSIGIIA
GAVKGLNEEQGNVVSRFGLKLVYGSTLVSVLSASIAALVL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory