Comparing 16639 FitnessBrowser__Keio:16639 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
2e4pA Crystal structure of bpha3 (oxidized form) (see paper)
46% identity, 93% coverage: 6:104/106 of query aligns to 5:104/108 of 2e4pA
1fqtA Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase (see paper)
44% identity, 95% coverage: 1:101/106 of query aligns to 1:102/109 of 1fqtA
3dqyA Crystal structure of toluene 2,3-dioxygenase ferredoxin (see paper)
41% identity, 95% coverage: 5:105/106 of query aligns to 4:104/106 of 3dqyA
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
44% identity, 95% coverage: 1:101/106 of query aligns to 3:103/104 of P0A185
Sites not aligning to the query:
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
44% identity, 95% coverage: 1:101/106 of query aligns to 2:102/103 of 2qpzA
2i7fA Sphingomonas yanoikuyae b1 ferredoxin (see paper)
41% identity, 95% coverage: 2:102/106 of query aligns to 1:102/102 of 2i7fA
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
45% identity, 94% coverage: 2:101/106 of query aligns to 2:101/102 of 5bokA
Q8GI16 Ferredoxin CarAc; Carbazole 1,9a-dioxygenase, ferredoxin component; CARDO from Pseudomonas resinovorans (see 2 papers)
37% identity, 93% coverage: 1:99/106 of query aligns to 1:102/107 of Q8GI16
4nbbE Carbazole- and oxygen-bound oxygenase with ile262 replaced by val and ferredoxin complex of carbazole 1,9a-dioxygenase (see paper)
36% identity, 92% coverage: 2:99/106 of query aligns to 1:101/114 of 4nbbE
3gceA Ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 (see paper)
33% identity, 78% coverage: 17:99/106 of query aligns to 19:101/104 of 3gceA
1z03A 2-oxoquinoline 8-monooxygenase component: active site modulation by rieske-[2fe-2s] center oxidation/reduction (see paper)
34% identity, 74% coverage: 26:103/106 of query aligns to 53:144/427 of 1z03A
Sites not aligning to the query:
1z01A 2-oxoquinoline 8-monooxygenase component: active site modulation by rieske-[2fe-2s] center oxidation/reduction (see paper)
34% identity, 74% coverage: 26:103/106 of query aligns to 53:144/427 of 1z01A
Sites not aligning to the query:
>16639 FitnessBrowser__Keio:16639
MNRIYACPVADVPEGEALRIDTSPVIALFNVGGEFYAINDRCSHGNASMSEGYLEDDATV
ECPLHAASFCLKTGKALCLPATDPLTTYPVHVEGGDIFIDLPEAQP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory