SitesBLAST
Comparing 16644 FitnessBrowser__Keio:16644 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
32% identity, 93% coverage: 14:343/353 of query aligns to 18:347/357 of 7y9pA
4cpdA Alcohol dehydrogenase tadh from thermus sp. Atn1
32% identity, 90% coverage: 31:349/353 of query aligns to 29:343/346 of 4cpdA
- active site: C38 (= C40), G39 (= G41), S40 (= S42), H43 (= H45), H59 (= H70), E60 (= E71), C89 (= C100), C92 (= C103), C95 (= C106), C103 (= C114), G107 (= G118), D152 (≠ C158), T156 (= T162), K340 (= K346)
- binding nicotinamide-adenine-dinucleotide: G39 (= G41), S40 (= S42), T156 (= T162), G178 (= G184), P179 (= P185), V180 (= V186), D200 (= D206), R201 (≠ M207), R205 (= R211), A243 (≠ C250), V244 (≠ S251), V266 (≠ I273), V268 (vs. gap), L292 (≠ S297), A293 (≠ W298), F333 (≠ M339)
- binding zinc ion: C38 (= C40), H59 (= H70), C89 (= C100), C92 (= C103), C95 (= C106), C103 (= C114), D152 (≠ C158)
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
31% identity, 98% coverage: 5:351/353 of query aligns to 5:338/339 of 5kiaA
- active site: C37 (= C40), G38 (= G41), T39 (≠ S42), H42 (= H45), H61 (= H70), E62 (= E71), C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114), V109 (≠ A120), P147 (≠ G159), A151 (= A163), K333 (= K346)
- binding calcium ion: D146 (≠ C158), N150 (≠ T162), E288 (≠ R293)
- binding zinc ion: C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114)
P80468 All-trans-retinol dehydrogenase [NAD(+)] ADH4; Alcohol dehydrogenase 4; Alcohol dehydrogenase class II; EC 1.1.1.105 from Struthio camelus (Common ostrich) (see 2 papers)
28% identity, 95% coverage: 15:351/353 of query aligns to 21:379/379 of P80468
Sites not aligning to the query:
- 1 modified: N-acetylthreonine
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
32% identity, 95% coverage: 17:351/353 of query aligns to 15:340/341 of P07913
- C38 (= C40) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
28% identity, 97% coverage: 7:350/353 of query aligns to 5:340/343 of 2ejvA
- active site: C38 (= C40), G39 (= G41), T40 (≠ S42), H43 (= H45), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114), Q111 (≠ A120), P149 (≠ C158), A153 (= A163), K336 (= K346)
- binding nicotinamide-adenine-dinucleotide: G172 (= G182), G174 (= G184), P175 (= P185), I176 (≠ V186), S195 (≠ V205), D196 (= D206), P197 (≠ M207), R201 (= R211), F238 (≠ C250), S239 (= S251), N241 (= N253), A244 (≠ G256), L261 (≠ I273), G262 (= G274), I263 (vs. gap)
- binding zinc ion: C38 (= C40), H63 (= H70), E64 (= E71), C96 (= C103), C99 (= C106), C107 (= C114)
2dq4A Crystal structure of threonine 3-dehydrogenase
28% identity, 97% coverage: 7:350/353 of query aligns to 5:340/343 of 2dq4A
- active site: C38 (= C40), G39 (= G41), T40 (≠ S42), H43 (= H45), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C99 (= C106), C107 (= C114), Q111 (≠ A120), P149 (≠ C158), A153 (= A163), K336 (= K346)
- binding zinc ion: C38 (= C40), H63 (= H70), E64 (= E71), C93 (= C100), C96 (= C103), C107 (= C114)
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
28% identity, 97% coverage: 7:350/353 of query aligns to 5:340/343 of Q5SKS4
- C38 (= C40) binding
- H63 (= H70) binding
- E64 (= E71) binding
- C93 (= C100) binding
- C96 (= C103) binding
- C99 (= C106) binding
- C107 (= C114) binding
- I176 (≠ V186) binding
- D196 (= D206) binding
- R201 (= R211) binding
- LGI 261:263 (≠ IG- 273:274) binding
- IAG 286:288 (≠ --Q 291) binding
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
31% identity, 95% coverage: 16:349/353 of query aligns to 16:343/346 of 2dfvA
- active site: C40 (= C40), G41 (= G41), T42 (≠ S42), H45 (= H45), H65 (= H70), E66 (= E71), C95 (= C100), C98 (= C103), C101 (= C106), C109 (= C114), K113 (≠ A120), P151 (≠ G159), A155 (= A163), K340 (= K346)
- binding nicotinamide-adenine-dinucleotide: G175 (= G184), P176 (= P185), L177 (≠ V186), E197 (≠ D206), P198 (≠ M207), R202 (= R211), F241 (≠ C250), S242 (= S251), A244 (≠ N253), L264 (≠ I273), G265 (= G274), L266 (vs. gap), I289 (≠ S297), T290 (≠ W298)
- binding zinc ion: C95 (= C100), C101 (= C106), C109 (= C114)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
31% identity, 95% coverage: 16:349/353 of query aligns to 18:345/348 of O58389
- C42 (= C40) binding
- T44 (≠ S42) mutation to A: Total loss of enzymatic activity.
- H67 (= H70) binding
- E68 (= E71) binding
- C97 (= C100) binding
- C100 (= C103) binding
- C103 (= C106) binding
- C111 (= C114) binding
- E152 (≠ C158) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ V186) binding
- E199 (≠ D206) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R211) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ IG- 273:274) binding
- IT 291:292 (≠ SW 297:298) binding
- R294 (≠ T300) mutation to A: 4000-fold decrease in catalytic efficiency.
P26325 Alcohol dehydrogenase 1; EC 1.1.1.1 from Gadus morhua subsp. callarias (Baltic cod) (Gadus callarias) (see paper)
26% identity, 99% coverage: 1:351/353 of query aligns to 7:374/375 of P26325
Sites not aligning to the query:
- 1 modified: N-acetylalanine
1cdoA Alcohol dehydrogenase (E.C.1.1.1.1) (ee isozyme) complexed with nicotinamide adenine dinucleotide (NAD), and zinc (see paper)
26% identity, 99% coverage: 1:351/353 of query aligns to 7:374/374 of 1cdoA
- active site: C46 (= C40), H47 (≠ G41), T48 (≠ S42), Y51 (≠ H45), H68 (= H70), E69 (= E71), C98 (= C100), C101 (= C103), C104 (= C106), C112 (= C114), W116 (vs. gap), C175 (= C158), T179 (= T162), R369 (≠ K346)
- binding nicotinamide-adenine-dinucleotide: C46 (= C40), H47 (≠ G41), T48 (≠ S42), C175 (= C158), T179 (= T162), G202 (= G184), V204 (= V186), D224 (= D206), L225 (≠ M207), V270 (≠ S251), G271 (= G252), V293 (≠ I273), W295 (≠ E275)
- binding zinc ion: C46 (= C40), H68 (= H70), C98 (= C100), C104 (= C106), C112 (= C114)
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
28% identity, 98% coverage: 4:349/353 of query aligns to 4:340/342 of 4ejmA
- active site: C40 (= C40), G41 (= G41), T42 (≠ S42), H45 (= H45), H61 (= H70), E62 (= E71), C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114), R109 (≠ A120), P147 (≠ G159), C151 (≠ A163), K337 (= K346)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G182), G172 (= G184), V173 (≠ P185), I174 (≠ V186), T194 (≠ E210), R195 (= R211), Q196 (≠ L212), K199 (≠ A215), C240 (= C250), E245 (≠ A255), T246 (≠ G256), L263 (≠ I273), V265 (vs. gap), I291 (≠ V299)
- binding zinc ion: C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114)
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
28% identity, 98% coverage: 4:349/353 of query aligns to 4:340/343 of 4ej6A
- active site: C40 (= C40), G41 (= G41), T42 (≠ S42), H45 (= H45), H61 (= H70), E62 (= E71), C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114), R109 (≠ A120), P147 (≠ G159), C151 (≠ A163), K337 (= K346)
- binding zinc ion: C91 (= C100), C94 (= C103), C97 (= C106), C105 (= C114)
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
30% identity, 96% coverage: 14:351/353 of query aligns to 12:336/338 of Q8GIX7
- C38 (= C40) binding
- H61 (= H70) binding
- E62 (= E71) binding
- C92 (= C100) binding
- C95 (= C103) binding
- C98 (= C106) binding
- C106 (= C114) binding
- C148 (= C158) binding
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
30% identity, 96% coverage: 14:351/353 of query aligns to 12:336/345 of 4z6kA
- active site: C38 (= C40), H39 (≠ G41), T40 (≠ S42), H43 (= H45), H61 (= H70), E62 (= E71), C92 (= C100), C95 (= C103), C98 (= C106), C106 (= C114), Q110 (≠ A120), C148 (= C158), T152 (= T162), R331 (≠ K346)
- binding zinc ion: C38 (= C40), H61 (= H70), C92 (= C100), C95 (= C103), C98 (= C106), C106 (= C114), C148 (= C158)
3cosD Crystal structure of human class ii alcohol dehydrogenase (adh4) in complex with NAD and zn
27% identity, 95% coverage: 17:351/353 of query aligns to 25:381/381 of 3cosD
- active site: C48 (= C40), H49 (≠ G41), T50 (≠ S42), T53 (≠ H45), H70 (= H70), E71 (= E71), C100 (= C100), C103 (= C103), C106 (= C106), C114 (= C114), S118 (vs. gap), C181 (= C158), T185 (= T162), R376 (≠ K346)
- binding nicotinamide-adenine-dinucleotide: H49 (≠ G41), T50 (≠ S42), C181 (= C158), T185 (= T162), G206 (= G182), V210 (= V186), D230 (= D206), I231 (≠ M207), C275 (= C250), A276 (≠ S251), T281 (≠ G256), I299 (= I273), G300 (= G274), V301 (vs. gap), R376 (≠ K346)
- binding zinc ion: C48 (= C40), H70 (= H70), C100 (= C100), C103 (= C103), C106 (= C106), C114 (= C114), C181 (= C158)
P08319 All-trans-retinol dehydrogenase [NAD(+)] ADH4; Alcohol dehydrogenase 2; Alcohol dehydrogenase 4; Alcohol dehydrogenase class II pi chain; EC 1.1.1.105 from Homo sapiens (Human) (see 2 papers)
27% identity, 95% coverage: 17:351/353 of query aligns to 24:380/380 of P08319
4uejA Closed state of galactitol-1-phosphate 5-dehydrogenase from e. Coli in complex with glycerol. (see paper)
28% identity, 91% coverage: 28:349/353 of query aligns to 26:344/346 of 4uejA
- active site: C38 (= C40), G39 (= G41), S40 (= S42), P43 (≠ H45), H59 (= H70), E60 (= E71), C89 (= C100), C92 (= C103), C95 (= C106), C103 (= C114), D107 (vs. gap), P145 (≠ G159), G149 (≠ A163), K341 (= K346)
- binding glycerol: H59 (= H70), E144 (≠ S157)
- binding zinc ion: C89 (= C100), C92 (= C103), C95 (= C106), C103 (= C114)
4a2cA Crystal structure of galactitol-1-phosphate dehydrogenase from escherichia coli (see paper)
28% identity, 91% coverage: 28:349/353 of query aligns to 26:344/346 of 4a2cA
- active site: C38 (= C40), G39 (= G41), S40 (= S42), P43 (≠ H45), H59 (= H70), E60 (= E71), C89 (= C100), C92 (= C103), C95 (= C106), C103 (= C114), D107 (vs. gap), P145 (≠ G159), G149 (≠ A163), K341 (= K346)
- binding zinc ion: C89 (= C100), C92 (= C103), C95 (= C106), C103 (= C114)
Query Sequence
>16644 FitnessBrowser__Keio:16644
MKTMLAAYLPGNSTVDLREVAVPTPGINQVLIKMKSSGICGSDVHYIYHQHRATAAAPDK
PLYQGFINGHEPCGQIVAMGQGCRHFKEGDRVLVYHISGCGFCPNCRRGFPISCTGEGKA
AYGWQRDGGHAEYLLAEEKDLILLPDALSYEDGAFISCGVGTAYEGILRGEVSGSDNVLV
VGLGPVGMMAMMLAKGRGAKRIIGVDMLPERLAMAKQLGVMDHGYLATTEGLPQIIAELT
HGGADVALDCSGNAAGRLLALQSTADWGRVVYIGETGKVEFEVSADLMHHQRRIIGSWVT
SLFHMEKCAHDLTDWKLWPRNAITHRFSLEQAGDAYALMASGKCGKVVINFPD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory