Comparing 16695 FitnessBrowser__Keio:16695 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
2pv7B Crystal structure of chorismate mutase / prephenate dehydrogenase (tyra) (1574749) from haemophilus influenzae rd at 2.00 a resolution (see paper)
57% identity, 75% coverage: 90:368/373 of query aligns to 1:280/280 of 2pv7B
5t9fB Prephenate dehydrogenase n222d mutant from soybean (see paper)
23% identity, 52% coverage: 106:299/373 of query aligns to 9:227/253 of 5t9fB
2gtvX Nmr structure of monomeric chorismate mutase from methanococcus jannaschii (see paper)
38% identity, 13% coverage: 1:50/373 of query aligns to 1:58/104 of 2gtvX
Sites not aligning to the query:
>16695 FitnessBrowser__Keio:16695
MVAELTALRDQIDEVDKALLNLLAKRLELVAEVGEVKSRFGLPIYVPEREASMLASRRAE
AEALGVPPDLIEDVLRRVMRESYSSENDKGFKTLCPSLRPVVIVGGGGQMGRLFEKMLTL
SGYQVRILEQHDWDRAADIVADAGMVIVSVPIHVTEQVIGKLPPLPKDCILVDLASVKNG
PLQAMLVAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRI
SAVEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDP
QLYADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFIDSFRKVEHWFGDYAQRFQSE
SRVLLRQANDNRQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory