SitesBLAST
Comparing 16750 FitnessBrowser__Keio:16750 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
39% identity, 93% coverage: 2:395/422 of query aligns to 3:405/410 of 8w78A
- binding 2-oxoglutaric acid: S48 (= S47), H52 (= H51), Y245 (= Y242), F254 (= F251), L255 (= L252), H258 (= H255), R349 (= R346)
- binding flavin-adenine dinucleotide: V8 (≠ I7), G11 (= G10), I12 (= I11), V13 (≠ I12), E34 (= E33), K35 (= K34), H42 (= H41), Q43 (= Q42), S44 (≠ T43), N47 (= N46), S48 (= S47), V50 (= V49), H52 (= H51), V173 (= V171), G203 (≠ S200), G204 (= G201), Q206 (≠ M203), R349 (= R346), P387 (= P377), G388 (≠ A378), A389 (= A379), T390 (= T380)
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
39% identity, 93% coverage: 2:395/422 of query aligns to 3:407/412 of 8w7fB
- binding flavin-adenine dinucleotide: G11 (= G10), I12 (= I11), V13 (≠ I12), E34 (= E33), K35 (= K34), H42 (= H41), Q43 (= Q42), S44 (≠ T43), H46 (= H45), N47 (= N46), S48 (= S47), V50 (= V49), H52 (= H51), V173 (= V171), G205 (≠ S200), G206 (= G201), Q208 (≠ M203), Y231 (= Y226), V350 (= V345), R351 (= R346), P389 (= P377), G390 (≠ A378), A391 (= A379), T392 (= T380)
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
29% identity, 63% coverage: 3:269/422 of query aligns to 4:271/366 of 3dmeA
- binding flavin-adenine dinucleotide: I8 (= I7), G9 (= G8), G11 (= G10), V12 (≠ I11), V13 (≠ I12), E32 (= E33), A33 (≠ K34), T41 (≠ Q42), S42 (≠ T43), R44 (≠ H45), N45 (= N46), S46 (= S47), V48 (= V49), H50 (= H51), P170 (≠ N179), L171 (≠ G180), A203 (≠ S200)
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
25% identity, 66% coverage: 3:280/422 of query aligns to 5:286/384 of 4x9mA
- binding flavin-adenine dinucleotide: G10 (= G8), G12 (= G10), I14 (= I12), E33 (= E33), K34 (= K34), E41 (≠ H41), T42 (≠ Q42), S43 (≠ T43), A45 (≠ H45), N46 (= N46), S47 (= S47), V49 (= V49), H51 (= H51), E176 (= E170), V177 (= V171), A209 (≠ S200), G210 (= G201), Y212 (≠ M203), Y234 (= Y226)
- binding sn-glycerol-3-phosphate: S47 (= S47), H51 (= H51), K258 (≠ L252), G259 (= G253)
Sites not aligning to the query:
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
25% identity, 66% coverage: 3:280/422 of query aligns to 5:286/384 of P75063
Sites not aligning to the query:
- 346:347 binding
- 352 binding
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
26% identity, 53% coverage: 2:225/422 of query aligns to 2:223/363 of 7cyxA
- binding flavin-adenine dinucleotide: I7 (= I7), G8 (= G8), G10 (= G10), V11 (≠ I11), I12 (= I12), V30 (≠ L32), E31 (= E33), K32 (= K34), E38 (≠ H41), A39 (≠ Q42), S40 (≠ T43), A43 (≠ N46), G45 (= G48), L46 (≠ V49), V171 (= V171), G200 (≠ S200), G201 (= G201), W203 (≠ M203)
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
24% identity, 53% coverage: 5:226/422 of query aligns to 53:272/866 of Q9UI17
- CV 59:60 (≠ II 11:12) binding
- EK 80:81 (= EK 33:34) binding
- 87:95 (vs. 40:49, 30% identical) binding
- H91 (= H45) modified: Tele-8alpha-FAD histidine
- H109 (≠ C66) to R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- V219 (= V171) binding
Sites not aligning to the query:
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
- 530 A → G: in dbSNP:rs1805073
- 646 S → P: in dbSNP:rs1805074
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
23% identity, 54% coverage: 4:231/422 of query aligns to 4:229/827 of 1pj7A
- active site: H222 (≠ G224)
- binding flavin-adenine dinucleotide: G8 (= G8), G10 (= G10), I11 (= I11), V12 (≠ I12), D32 (≠ L32), Q33 (≠ E33), G41 (≠ H41), S42 (≠ Q42), T43 (= T43), H45 (= H45), P47 (≠ S47), L49 (≠ V49), T170 (≠ E170), V171 (= V171), A200 (≠ S200), G201 (= G201), W203 (≠ M203), H222 (≠ G224)
Sites not aligning to the query:
- active site: 256, 549
- binding flavin-adenine dinucleotide: 256, 331, 357, 358, 359, 360
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: 505, 536, 549, 551, 563, 629, 648, 655, 696
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
23% identity, 54% coverage: 4:231/422 of query aligns to 4:229/827 of 3gsiA
- active site: H222 (≠ G224)
- binding flavin-adenine dinucleotide: G10 (= G10), I11 (= I11), V12 (≠ I12), D32 (≠ L32), Q33 (≠ E33), G41 (≠ H41), S42 (≠ Q42), T43 (= T43), H45 (= H45), P47 (≠ S47), L49 (≠ V49), T170 (≠ E170), V171 (= V171), A200 (≠ S200), G201 (= G201), W203 (≠ M203), H222 (≠ G224)
Sites not aligning to the query:
- active site: 256, 549
- binding flavin-adenine dinucleotide: 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
- binding (6s)-5,6,7,8-tetrahydrofolate: 505, 536, 551, 563, 629, 648, 655, 696
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
23% identity, 54% coverage: 4:231/422 of query aligns to 5:230/828 of 1pj6A
- active site: H223 (≠ G224)
- binding flavin-adenine dinucleotide: G9 (= G8), G11 (= G10), I12 (= I11), V13 (≠ I12), D33 (≠ L32), Q34 (≠ E33), G42 (≠ H41), S43 (≠ Q42), T44 (= T43), H46 (= H45), P48 (≠ S47), L50 (≠ V49), V172 (= V171), A201 (≠ S200), G202 (= G201), W204 (≠ M203), H223 (≠ G224)
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
23% identity, 54% coverage: 4:231/422 of query aligns to 7:232/830 of Q9AGP8
- IV 14:15 (≠ II 11:12) binding
- DQ 35:36 (≠ LE 32:33) binding
- STSH 45:48 (≠ QTGH 42:45) binding
- L52 (≠ V49) binding
- V174 (= V171) binding
- H225 (≠ G224) Important for catalytic activity; mutation to Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
Sites not aligning to the query:
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
- 539 binding
- 552 Important for catalytic activity; D→A: No effect on the activity.; D→N: Reduces activity 3-fold.
2gb0B Monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme (see paper)
22% identity, 57% coverage: 2:243/422 of query aligns to 4:242/389 of 2gb0B
- active site: H45 (= H45), T48 (≠ G48), R49 (≠ V49), R52 (vs. gap), S98 (≠ M90)
- binding flavin-adenine dinucleotide: G10 (= G8), S13 (≠ I11), M14 (≠ I12), D33 (≠ E33), A34 (≠ K34), H39 (≠ A39), S43 (≠ T43), H44 (≠ G44), R49 (≠ V49), I50 (= I50), R172 (≠ E170), V173 (= V171), S200 (≠ C199), M201 (≠ S200), G202 (= G201), W204 (≠ M203)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 342, 344, 345, 346, 347, 348
3qseA Crystal structure for the complex of substrate-reduced msox with sarcosine (see paper)
22% identity, 57% coverage: 2:243/422 of query aligns to 4:242/385 of 3qseA
- active site: H45 (= H45), T48 (≠ G48), R49 (≠ V49), R52 (vs. gap), S98 (≠ M90)
- binding flavin-adenine dinucleotide: G10 (= G8), S13 (≠ I11), M14 (≠ I12), D33 (≠ E33), A34 (≠ K34), H39 (≠ A39), S43 (≠ T43), H44 (≠ G44), R49 (≠ V49), I50 (= I50), V173 (= V171), M201 (≠ S200), G202 (= G201), W204 (≠ M203)
- binding sarcosine: I50 (= I50), R52 (vs. gap)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding chloride ion: 317, 342
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 344, 345, 346, 347, 348
- binding sarcosine: 245, 254, 269, 344, 345, 348
2gf3A Structure of the complex of monomeric sarcosine with its substrate analogue inhibitor 2-furoic acid at 1.3 a resolution.
22% identity, 57% coverage: 2:243/422 of query aligns to 4:242/385 of 2gf3A
- active site: H45 (= H45), T48 (≠ G48), R49 (≠ V49), R52 (vs. gap), S98 (≠ M90)
- binding flavin-adenine dinucleotide: G10 (= G8), S13 (≠ I11), M14 (≠ I12), D33 (≠ E33), A34 (≠ K34), H39 (≠ A39), G42 (≠ Q42), S43 (≠ T43), H44 (≠ G44), R49 (≠ V49), I50 (= I50), R172 (≠ E170), V173 (= V171), M201 (≠ S200), G202 (= G201), W204 (≠ M203)
- binding 2-furoic acid: I50 (= I50), R52 (vs. gap), P217 (≠ I218), Q219 (≠ C220), Y221 (≠ F222)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 344, 345, 346, 347, 348
- binding 2-furoic acid: 245, 254, 319, 320, 321, 345, 348
2a89A Monomeric sarcosine oxidase: structure of a covalently flavinylated amine oxidizing enzyme (see paper)
22% identity, 57% coverage: 2:243/422 of query aligns to 4:242/385 of 2a89A
- active site: H45 (= H45), T48 (≠ G48), R49 (≠ V49), R52 (vs. gap), S98 (≠ M90)
- binding (n5,c4a)-(alpha-hydroxy-propano)-3,4,4a,5-tetrahydro-flavin-adenine dinucleotide: G10 (= G8), S13 (≠ I11), M14 (≠ I12), D33 (≠ E33), A34 (≠ K34), H39 (≠ A39), G42 (≠ Q42), S43 (≠ T43), H44 (≠ G44), R49 (≠ V49), I50 (= I50), R172 (≠ E170), V173 (= V171), M201 (≠ S200), G202 (= G201), W204 (≠ M203)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding (n5,c4a)-(alpha-hydroxy-propano)-3,4,4a,5-tetrahydro-flavin-adenine dinucleotide: 254, 256, 315, 316, 317, 344, 345, 346, 347, 348
1eliA Complex of monomeric sarcosine oxidase with the inhibitor pyrrole-2- carboxylate (see paper)
22% identity, 57% coverage: 2:243/422 of query aligns to 4:242/385 of 1eliA
- active site: H45 (= H45), T48 (≠ G48), R49 (≠ V49), R52 (vs. gap), S98 (≠ M90)
- binding flavin-adenine dinucleotide: G10 (= G8), G12 (= G10), S13 (≠ I11), M14 (≠ I12), D33 (≠ E33), A34 (≠ K34), H39 (≠ A39), G42 (≠ Q42), S43 (≠ T43), H44 (≠ G44), R49 (≠ V49), I50 (= I50), R172 (≠ E170), V173 (= V171), S200 (≠ C199), M201 (≠ S200), G202 (= G201), W204 (≠ M203)
- binding pyrrole-2-carboxylate: R52 (vs. gap)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 342, 344, 345, 346, 347, 348
- binding pyrrole-2-carboxylate: 245, 254, 269, 344, 345, 348
1el9A Complex of monomeric sarcosine oxidase with the inhibitor [methylthio]acetate (see paper)
22% identity, 57% coverage: 2:243/422 of query aligns to 4:242/385 of 1el9A
- active site: H45 (= H45), T48 (≠ G48), R49 (≠ V49), R52 (vs. gap), S98 (≠ M90)
- binding flavin-adenine dinucleotide: G10 (= G8), S13 (≠ I11), M14 (≠ I12), D33 (≠ E33), A34 (≠ K34), H39 (≠ A39), G42 (≠ Q42), S43 (≠ T43), H44 (≠ G44), R49 (≠ V49), I50 (= I50), R172 (≠ E170), V173 (= V171), S200 (≠ C199), M201 (≠ S200), G202 (= G201), W204 (≠ M203)
- binding [methylthio]acetate: I50 (= I50), R52 (vs. gap)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 344, 345, 346, 347, 348
- binding [methylthio]acetate: 245, 254, 269, 344, 348
1el8A Complex of monomeric sarcosine oxidase with the inhibitor [methylseleno]cetate (see paper)
22% identity, 57% coverage: 2:243/422 of query aligns to 4:242/385 of 1el8A
- active site: H45 (= H45), T48 (≠ G48), R49 (≠ V49), R52 (vs. gap), S98 (≠ M90)
- binding flavin-adenine dinucleotide: G10 (= G8), S13 (≠ I11), M14 (≠ I12), D33 (≠ E33), A34 (≠ K34), H39 (≠ A39), G42 (≠ Q42), S43 (≠ T43), H44 (≠ G44), R49 (≠ V49), I50 (= I50), R172 (≠ E170), V173 (= V171), M201 (≠ S200), G202 (= G201), W204 (≠ M203)
- binding [methylseleno]acetate: I50 (= I50), R52 (vs. gap)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 344, 345, 346, 347, 348
- binding [methylseleno]acetate: 245, 254, 344, 345, 348
1el7A Complex of monomeric sarcosine oxidase with the inhibitor [methytelluro]acetate (see paper)
22% identity, 57% coverage: 2:243/422 of query aligns to 4:242/385 of 1el7A
- active site: H45 (= H45), T48 (≠ G48), R49 (≠ V49), R52 (vs. gap), S98 (≠ M90)
- binding flavin-adenine dinucleotide: G10 (= G8), S13 (≠ I11), M14 (≠ I12), V32 (≠ L32), D33 (≠ E33), A34 (≠ K34), H39 (≠ A39), G42 (≠ Q42), S43 (≠ T43), H44 (≠ G44), R49 (≠ V49), I50 (= I50), R172 (≠ E170), V173 (= V171), S200 (≠ C199), M201 (≠ S200), G202 (= G201), W204 (≠ M203)
- binding [methyltelluro]acetate: I50 (= I50), R52 (vs. gap)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 342, 344, 345, 346, 347, 348
- binding [methyltelluro]acetate: 245, 254, 269, 344, 345, 348
1el5A Complex of monomeric sarcosine oxidase with the inhibitor dimethylglycine (see paper)
22% identity, 57% coverage: 2:243/422 of query aligns to 4:242/385 of 1el5A
- active site: H45 (= H45), T48 (≠ G48), R49 (≠ V49), R52 (vs. gap), S98 (≠ M90)
- binding n,n-dimethylglycine: I50 (= I50), R52 (vs. gap)
- binding flavin-adenine dinucleotide: G10 (= G8), G12 (= G10), S13 (≠ I11), M14 (≠ I12), V32 (≠ L32), D33 (≠ E33), A34 (≠ K34), H39 (≠ A39), G42 (≠ Q42), S43 (≠ T43), H44 (≠ G44), R49 (≠ V49), I50 (= I50), R172 (≠ E170), V173 (= V171), S200 (≠ C199), M201 (≠ S200), G202 (= G201), W204 (≠ M203)
Sites not aligning to the query:
- active site: 254, 265, 269, 315, 345, 348
- binding n,n-dimethylglycine: 245, 254, 269, 344, 345, 348
- binding flavin-adenine dinucleotide: 254, 315, 316, 317, 342, 344, 345, 346, 347, 348
Query Sequence
>16750 FitnessBrowser__Keio:16750
MYDFVIIGGGIIGMSTAMQLIDVYPDARIALLEKESAPACHQTGHNSGVIHAGVYYTPGS
LKAQFCLAGNRATKAFCDQNGIRYDNCGKMLVATSDLEMERMRALWERTAANGIEREWLN
ADELREREPNITGLGGIFVPSSGIVSYRDVTAAMAKIFQSRGGEIIYNAEVSGLNEHKNG
VVIRTRQGGEYEASTLISCSGLMADRLVKMLGLEPGFIICPFRGEYFRLAPEHNQIVNHL
IYPIPDPAMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRKRDFSFSDTLEILGSSGIRR
VLQNHLRSGLGEMKNSLCKSGYLRLVQKYCPRLSLSDLQPWPAGVRAQAVSPDGKLIDDF
LFVTTPRTIHTCNAPSPAATSAIPIGAHIVSKVQTLLASQSNPGRTLRAARSVDALHAAF
NQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory