Comparing 16767 FitnessBrowser__Keio:16767 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
48% identity, 98% coverage: 3:392/400 of query aligns to 1:380/382 of 7ahhC
7aheC Opua inhibited inward facing (see paper)
48% identity, 98% coverage: 3:392/400 of query aligns to 1:380/382 of 7aheC
7ahdC Opua (e190q) occluded (see paper)
60% identity, 65% coverage: 3:262/400 of query aligns to 1:260/260 of 7ahdC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
44% identity, 58% coverage: 33:264/400 of query aligns to 11:242/375 of 2d62A
1g291 Malk (see paper)
43% identity, 55% coverage: 44:264/400 of query aligns to 19:239/372 of 1g291
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
42% identity, 58% coverage: 49:281/400 of query aligns to 38:261/378 of P69874
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
41% identity, 56% coverage: 44:268/400 of query aligns to 17:239/240 of 4ymuJ
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
41% identity, 60% coverage: 35:274/400 of query aligns to 9:242/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
41% identity, 60% coverage: 35:274/400 of query aligns to 9:242/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
41% identity, 60% coverage: 35:274/400 of query aligns to 9:242/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
41% identity, 60% coverage: 35:274/400 of query aligns to 9:242/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
39% identity, 66% coverage: 5:268/400 of query aligns to 3:239/241 of 4u00A
8hplC Lpqy-sugabc in state 1 (see paper)
39% identity, 63% coverage: 43:292/400 of query aligns to 16:260/384 of 8hplC
Sites not aligning to the query:
8hprD Lpqy-sugabc in state 4 (see paper)
39% identity, 63% coverage: 43:292/400 of query aligns to 18:262/362 of 8hprD
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 57% coverage: 43:268/400 of query aligns to 20:244/343 of P30750
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
39% identity, 63% coverage: 43:292/400 of query aligns to 18:262/363 of 8hprC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
38% identity, 57% coverage: 43:268/400 of query aligns to 21:245/344 of 6cvlD
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
38% identity, 57% coverage: 43:268/400 of query aligns to 21:245/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
38% identity, 57% coverage: 43:268/400 of query aligns to 21:245/344 of 3tuiC
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
33% identity, 82% coverage: 35:361/400 of query aligns to 7:320/348 of 3d31A
Sites not aligning to the query:
>16767 FitnessBrowser__Keio:16767
MAIKLEIKNLYKIFGEHPQRAFKYIEQGLSKEQILEKTGLSLGVKDASLAIEEGEIFVIM
GLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELREVRRKKIAMVFQSFALMPH
MTVLDNTAFGMELAGINAEERREKALDALRQVGLENYAHSYPDELSGGMRQRVGLARALA
INPDILLMDEAFSALDPLIRTEMQDELVKLQAKHQRTIVFISHDLDEAMRIGDRIAIMQN
GEVVQVGTPDEILNNPANDYVRTFFRGVDISQVFSAKDIARRTPNGLIRKTPGFGPRSAL
KLLQDEDREYGYVIERGNKFVGAVSIDSLKTALTQQQGLDAALIDAPLAVDAQTPLSELL
SHVGQAPCAVPVVDEDQQYVGIISKGMLLRALDREGVNNG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory