SitesBLAST
Comparing 16779 FitnessBrowser__Keio:16779 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4g9bA Crystal structure of beta-phosphoglucomutase homolog from escherichia coli, target efi-501172, with bound mg, open lid
29% identity, 97% coverage: 4:185/188 of query aligns to 3:191/227 of 4g9bA
- active site: D10 (= D11), L11 (≠ M12), D12 (= D13), T18 (= T19), K46 (≠ N47), S117 (= S111), V118 (≠ E112), K148 (= K142), E172 (= E166), D173 (= D167)
- binding magnesium ion: D10 (= D11), D12 (= D13), D173 (= D167)
Q8VZ10 Protein SUPPRESSOR OF QUENCHING 1, chloroplastic; EC 3.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 98% coverage: 2:186/188 of query aligns to 71:261/1055 of Q8VZ10
- D80 (= D11) mutation to N: Complete rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
Sites not aligning to the query:
- 431:434 CINC→SINS: No rescue in complementation test of the nonphotochemical quenching (NPQ) phenotype observed in disrupted plants.
- 859 E→K: In soq1-2; high light intensity-dependent and irreversible nonphotochemical quenching (NPQ) due to a decrease in chlorophyll excited-state lifetime.
4c4sA Structure of beta-phosphoglucomutase in complex with an alpha- fluorophosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:179/215 of 4c4sA
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S111 (= S111), A112 (≠ E112), K142 (= K142), E166 (= E166), D167 (= D167)
- binding (1R)-1,5-anhydro-1-[(S)-fluoro(phosphono)methyl]-D-glucitol: D10 (= D13), H20 (= H23), W24 (= W27), L44 (= L46), G46 (= G48), V47 (≠ S49), R49 (≠ T51), S113 (= S113)
- binding magnesium ion: D8 (= D11), D10 (= D13), D167 (= D167)
- binding trifluoromagnesate: D8 (= D11), L9 (≠ M12), D10 (= D13), S111 (= S111), A112 (≠ E112), K142 (= K142)
6w04A Crystal structure of had hydrolase, family ia, variant 3 from entamoeba histolytica hm-1:imss
28% identity, 92% coverage: 7:179/188 of query aligns to 3:181/223 of 6w04A
- active site: D7 (= D11), F8 (≠ M12), N9 (≠ D13), D15 (≠ T19), N44 (= N47), T109 (= T109), S110 (≠ G110), K144 (= K142), E168 (= E166), D169 (= D167)
- binding magnesium ion: D7 (= D11), N9 (≠ D13), D169 (= D167)
7ocrB NADPH and fructose-6-phosphate bound to the dehydrogenase domain of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
32% identity, 91% coverage: 7:178/188 of query aligns to 11:180/675 of 7ocrB
Sites not aligning to the query:
- binding fructose -6-phosphate: 362, 403, 508, 513, 516, 587, 590, 594, 595, 601
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 244, 246, 247, 248, 273, 274, 329, 330, 333, 361, 362, 406, 587, 590
7ocnA Crystal structure of the bifunctional mannitol-1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
31% identity, 91% coverage: 7:178/188 of query aligns to 11:186/690 of 7ocnA
7ocqA Nadh bound to the dehydrogenase domain of the bifunctional mannitol-1- phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
31% identity, 91% coverage: 7:178/188 of query aligns to 11:186/686 of 7ocqA
Sites not aligning to the query:
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(3-aminocarbonyl-4~{H}-pyridin-1-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-3,4,5-tris(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: 252, 253, 254, 279, 280, 335, 369, 370
7ocpA NADPH bound to the dehydrogenase domain of the bifunctional mannitol- 1-phosphate dehydrogenase/phosphatase mtld from acinetobacter baumannii (see paper)
31% identity, 91% coverage: 7:178/188 of query aligns to 11:186/688 of 7ocpA
Sites not aligning to the query:
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: 250, 251, 253, 254, 279, 280, 334, 335, 336, 339, 369, 370
P71447 Beta-phosphoglucomutase; Beta-PGM; EC 5.4.2.6 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see 3 papers)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/221 of P71447
- D8 (= D11) modified: 4-aspartylphosphate; mutation to A: Inactive.; mutation to E: Inactive.
- D10 (= D13) mutation to A: Inactive.; mutation to E: Inactive.; mutation to N: Inactive.; mutation to S: Inactive.
- T16 (= T19) mutation to P: 500-fold reduction in the rate constant for Asp-8 phosphorylation by beta-G1,6bisP. 6,700-fold reduction in the apparent rate constant for cycling of the phosphorylated enzyme to convert beta-G1P to G6P. 13-fold increase in the estimated rate constant for phosphoryl transfer from the phospho-Asp8 to water.
- H20 (= H23) mutation to A: Impairs Asp-8 phosphorylation by beta-G1,6bisP and phosphoryl transfer from the phospho-Asp8 to the substrate beta-G1P.; mutation to N: 300-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.; mutation to Q: 8-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- K45 (≠ N47) mutation to A: 20'000-fold decrease in kcat/KM.
- G46 (= G48) mutation to A: 1'000'000-fold decrease in kcat/KM.; mutation to P: 100'000-fold decrease in kcat/KM.; mutation to V: 10'000-fold decrease in kcat/KM.
- R49 (≠ T51) mutation to K: 1'000'000-fold decrease in kcat/KM.
- S52 (≠ I54) mutation to A: Wild-type activity.
- K76 (= K75) mutation to A: 100-fold reduction in the conversion of beta-G1P to G6P in the presence of beta-G1,6bisP.
- D170 (= D167) mutation to A: Impaired, but active with an increase in the affinity for G1P.
6qzgA Beta-glucose 1,6-bisphosphonate bound to wild type beta- phosphoglucomutse in an open conformation.
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/219 of 6qzgA
- binding 3,7-anhydro-1,2,8-trideoxy-1,8-diphosphono-D-glycero-D-gulo-octitol: D8 (= D11), L9 (≠ M12), D10 (= D13), H20 (= H23), G46 (= G48), S114 (= S111), A115 (≠ E112), S116 (= S113), K117 (≠ A114), K145 (= K142)
- binding magnesium ion: D8 (= D11), D10 (= D13), D170 (= D167)
2wf9A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, and beryllium trifluoride, crystal form 2 (see paper)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/221 of 2wf9A
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S114 (= S111), A115 (≠ E112), K145 (= K142), E169 (= E166), D170 (= D167)
- binding beryllium trifluoride ion: D8 (= D11), L9 (≠ M12), D10 (= D13), S114 (= S111), A115 (≠ E112), K145 (= K142)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D13), H20 (= H23), G46 (= G48), V47 (≠ S49), R49 (≠ T51), S116 (= S113), K117 (≠ A114), N118 (≠ I115)
- binding 6-O-phosphono-alpha-D-glucopyranose: D10 (= D13), H20 (= H23), G46 (= G48), V47 (≠ S49), R49 (≠ T51), A115 (≠ E112), S116 (= S113), K117 (≠ A114), N118 (≠ I115)
- binding magnesium ion: D8 (= D11), D10 (= D13), D170 (= D167)
1z4nA Structure of beta-phosphoglucomutase with inhibitor bound alpha- galactose 1-phosphate cocrystallized with fluoride (see paper)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/219 of 1z4nA
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S114 (= S111), A115 (≠ E112), K145 (= K142), E169 (= E166), D170 (= D167)
- binding 1-O-phosphono-alpha-D-galactopyranose: H20 (= H23), W24 (= W27), V47 (≠ S49), R49 (≠ T51), S116 (= S113), K117 (≠ A114), N118 (≠ I115)
- binding magnesium ion: D8 (= D11), D10 (= D13), E169 (= E166), D170 (= D167)
1o03A Structure of pentavalent phosphorous intermediate of an enzyme catalyzed phosphoryl transfer reaction observed on cocrystallization with glucose 6-phosphate (see paper)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/221 of 1o03A
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S114 (= S111), A115 (≠ E112), K145 (= K142), E169 (= E166), D170 (= D167)
- binding 1,6-di-O-phosphono-alpha-D-glucopyranose: D8 (= D11), L9 (≠ M12), D10 (= D13), H20 (= H23), G46 (= G48), V47 (≠ S49), R49 (≠ T51), S114 (= S111), A115 (≠ E112), S116 (= S113), K117 (≠ A114), K145 (= K142)
- binding magnesium ion: D8 (= D11), D10 (= D13), D170 (= D167)
1lvhA The structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution (see paper)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/221 of 1lvhA
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S114 (= S111), A115 (≠ E112), K145 (= K142), E169 (= E166), D170 (= D167)
- binding magnesium ion: D8 (= D11), D10 (= D13), D170 (= D167)
6h91A Phosphorylated beta-phosphoglucomutase from lactococcus lactis in an open conformer to 2.4 a
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/218 of 6h91A
4c4rA Structure of beta-phosphoglucomutase in complex with a phosphonate analogue of beta-glucose-1-phosphate and magnesium trifluoride (see paper)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/218 of 4c4rA
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S114 (= S111), A115 (≠ E112), K145 (= K142), E169 (= E166), D170 (= D167)
- binding magnesium ion: D8 (= D11), D10 (= D13), D170 (= D167)
- binding trifluoromagnesate: D8 (= D11), L9 (≠ M12), D10 (= D13), S114 (= S111), A115 (≠ E112), K145 (= K142)
- binding (1R)-1,5-anhydro-1-(phosphonomethyl)-D-glucitol: D10 (= D13), H20 (= H23), W24 (= W27), L44 (= L46), G46 (= G48), V47 (≠ S49), R49 (≠ T51), S52 (≠ I54), S116 (= S113), K117 (≠ A114)
3zi4A The structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and scandium tetrafluoride
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/218 of 3zi4A
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S114 (= S111), A115 (≠ E112), K145 (= K142), E169 (= E166), D170 (= D167)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D13), H20 (= H23), G46 (= G48), V47 (≠ S49), R49 (≠ T51), S116 (= S113), K117 (≠ A114)
- binding magnesium ion: D8 (= D11), D10 (= D13), D170 (= D167)
- binding Scandium Tetrafluoride: D8 (= D11), L9 (≠ M12), D10 (= D13), S114 (= S111), A115 (≠ E112), K145 (= K142)
2wf8A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate, glucose-1-phosphate and beryllium trifluoride (see paper)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/218 of 2wf8A
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S114 (= S111), A115 (≠ E112), K145 (= K142), E169 (= E166), D170 (= D167)
- binding beryllium trifluoride ion: D8 (= D11), L9 (≠ M12), D10 (= D13), S114 (= S111), A115 (≠ E112), K145 (= K142)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D13), H20 (= H23), G46 (= G48), V47 (≠ S49), R49 (≠ T51), A115 (≠ E112), S116 (= S113), K117 (≠ A114)
- binding 1-O-phosphono-alpha-D-glucopyranose: D10 (= D13), H20 (= H23), W24 (= W27), L44 (= L46), G46 (= G48), V47 (≠ S49), R49 (≠ T51), S52 (≠ I54), A115 (≠ E112), S116 (= S113), K117 (≠ A114)
- binding magnesium ion: D8 (= D11), D10 (= D13), D170 (= D167)
2wf7A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphonate and aluminium tetrafluoride (see paper)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/218 of 2wf7A
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S114 (= S111), A115 (≠ E112), K145 (= K142), E169 (= E166), D170 (= D167)
- binding tetrafluoroaluminate ion: D8 (= D11), L9 (≠ M12), D10 (= D13), S114 (= S111), K145 (= K142)
- binding 6,7-dideoxy-7-phosphono-beta-D-gluco-heptopyranose: D10 (= D13), G46 (= G48), V47 (≠ S49), R49 (≠ T51), S116 (= S113), K117 (≠ A114), N118 (≠ I115)
- binding magnesium ion: D8 (= D11), D10 (= D13), D170 (= D167)
2wf6A Structure of beta-phosphoglucomutase inhibited with glucose-6- phosphate and aluminium tetrafluoride (see paper)
29% identity, 93% coverage: 5:179/188 of query aligns to 2:182/218 of 2wf6A
- active site: D8 (= D11), L9 (≠ M12), D10 (= D13), T16 (= T19), K45 (≠ N47), S114 (= S111), A115 (≠ E112), K145 (= K142), E169 (= E166), D170 (= D167)
- binding tetrafluoroaluminate ion: D8 (= D11), L9 (≠ M12), D10 (= D13), S114 (= S111), K145 (= K142)
- binding 6-O-phosphono-beta-D-glucopyranose: D10 (= D13), G46 (= G48), V47 (≠ S49), R49 (≠ T51), S116 (= S113), K117 (≠ A114)
- binding magnesium ion: D8 (= D11), D10 (= D13), D170 (= D167)
Query Sequence
>16779 FitnessBrowser__Keio:16779
MYERYAGLIFDMDGTILDTEPTHRKAWREVLGHYGLQYDIQAMIALNGSPTWRIAQAIIE
LNQADLDPHALAREKTEAVRSMLLDSVEPLPLVDVVKSWHGRRPMAVGTGSESAIAEALL
AHLGLRHYFDAVVAADHVKHHKPAPDTFLLCAQRMGVQPTQCVVFEDADFGIQAARAAGM
DAVDVRLL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory