SitesBLAST
Comparing 16789 FitnessBrowser__Keio:16789 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P73574 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100 from Synechocystis sp. (strain PCC 6803 / Kazusa) (see paper)
35% identity, 99% coverage: 3:259/259 of query aligns to 7:247/247 of P73574
- A14 (≠ G10) mutation to G: 4.2-fold increase in activity on acetoacetyl-CoA.
- P151 (≠ K149) mutation to F: 2.7-fold increase in activity on acetoacetyl-CoA.; mutation to V: 5.7-fold increase in activity on acetoacetyl-CoA.
- K160 (= K158) mutation to A: Almost no activity on acetoacetyl-CoA.
- F188 (≠ L187) mutation to Y: 3.3-fold increase in activity on acetoacetyl-CoA.
- N198 (≠ K207) mutation to R: 3.5-fold increase in activity on acetoacetyl-CoA.
7pcsB Structure of the heterotetrameric sdr family member bbscd (see paper)
30% identity, 100% coverage: 2:259/259 of query aligns to 4:245/247 of 7pcsB
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), M16 (≠ L14), D35 (= D33), I36 (= I34), I62 (≠ A62), N88 (≠ S88), G90 (= G90), I138 (= I139), S140 (= S141), Y152 (= Y154), K156 (= K158), I185 (≠ L188)
Q9KJF1 (2S)-[(R)-hydroxy(phenyl)methyl]succinyl-CoA dehydrogenase subunit BbsD; (S,R)-2-(alpha-hydroxybenzyl)succinyl-CoA dehydrogenase subunit BbsD; EC 1.1.1.429 from Thauera aromatica (see 2 papers)
30% identity, 100% coverage: 2:259/259 of query aligns to 5:246/248 of Q9KJF1
- S15 (≠ Q12) binding
- D36 (= D33) binding
- D62 (= D61) binding
- I63 (≠ A62) binding
- N89 (≠ S88) binding
- Y153 (= Y154) binding
- K157 (= K158) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 100% coverage: 1:258/259 of query aligns to 3:246/246 of 3osuA
4cqlI Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD (see paper)
33% identity, 98% coverage: 4:258/259 of query aligns to 10:251/251 of 4cqlI
- active site: G19 (≠ T13), S146 (= S141), Y159 (= Y154), K163 (= K158)
- binding nicotinamide-adenine-dinucleotide: S18 (≠ Q12), G19 (≠ T13), I20 (≠ L14), D39 (= D33), L40 (≠ I34), A64 (= A60), D65 (= D61), V66 (≠ A62), C93 (vs. gap), A94 (= A89), G95 (= G90), I96 (= I91), V116 (= V111), I144 (= I139), S146 (= S141), Y159 (= Y154), K163 (= K158), P189 (≠ L184), G190 (= G185), I192 (≠ L188), T194 (≠ S190), M196 (= M192)
4cqmA Crystal structure of heterotetrameric human ketoacyl reductase complexed with NAD and NADP (see paper)
33% identity, 98% coverage: 4:258/259 of query aligns to 8:248/248 of 4cqmA
- active site: G17 (≠ T13), S143 (= S141), Y156 (= Y154), K160 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G9), S16 (≠ Q12), G17 (≠ T13), I18 (≠ L14), D37 (= D33), L38 (≠ I34), A61 (= A60), V63 (≠ A62), C90 (vs. gap), A91 (= A89), G92 (= G90), I93 (= I91), V113 (= V111), I141 (= I139), S143 (= S141), Y156 (= Y154), K160 (= K158), P186 (≠ L184), G187 (= G185), I189 (≠ L188), T191 (≠ S190), P192 (= P191), M193 (= M192), T194 (≠ F193)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
31% identity, 99% coverage: 3:258/259 of query aligns to 6:247/247 of 4jroC
- active site: G16 (≠ T13), S142 (= S141), Q152 (≠ N151), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (≠ G11), R15 (≠ Q12), G16 (≠ T13), I17 (≠ L14), N35 (≠ V32), Y36 (≠ D33), N37 (≠ I34), G38 (≠ Q35), S39 (= S36), N63 (≠ D61), V64 (≠ A62), N90 (≠ S88), A91 (= A89), I93 (= I91), I113 (≠ V111), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (≠ L184), I188 (≠ L188), T190 (≠ S190)
Q48436 Diacetyl reductase [(S)-acetoin forming]; Acetoin(diacetyl) reductase; AR; Meso-2,3-butanediol dehydrogenase; EC 1.1.1.304 from Klebsiella pneumoniae (see paper)
31% identity, 99% coverage: 1:257/259 of query aligns to 1:254/256 of Q48436
- 6:33 (vs. 6:33, 36% identical) binding
- D59 (= D61) binding
- K156 (= K158) binding
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
33% identity, 98% coverage: 3:255/259 of query aligns to 7:248/252 of 1vl8B
- active site: G17 (≠ T13), S143 (= S141), I154 (≠ N151), Y157 (= Y154), K161 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G9), R16 (≠ Q12), G17 (≠ T13), L18 (= L14), S37 (≠ D33), R38 (≠ I34), C63 (≠ A60), D64 (= D61), V65 (≠ A62), A91 (≠ S88), A92 (= A89), G93 (= G90), I94 (= I91), V114 (= V111), I141 (= I139), S143 (= S141), Y157 (= Y154), K161 (= K158), P187 (≠ L184), G188 (= G185), Y190 (≠ L188), T192 (≠ S190), M194 (= M192), T195 (≠ F193)
Q92506 (3R)-3-hydroxyacyl-CoA dehydrogenase; 17-beta-hydroxysteroid dehydrogenase 8; 17-beta-HSD 8; HSD17B8; 3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit; KAR alpha subunit; 3-oxoacyl-[acyl-carrier-protein] reductase; Estradiol 17-beta-dehydrogenase 8; Protein Ke6; Ke6; Short chain dehydrogenase/reductase family 30C member 1; Testosterone 17-beta-dehydrogenase 8; EC 1.1.1.n12; EC 1.1.1.62; EC 1.1.1.239 from Homo sapiens (Human) (see 2 papers)
33% identity, 98% coverage: 4:258/259 of query aligns to 13:261/261 of Q92506
- 15:23 (vs. 6:14, 33% identical) binding
- D42 (= D33) mutation to A: Reduced NADH-dependent reductase activity with acetoacetyl-CoA. Reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Increases NADPH-dependent reductase activities. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- DL 42:43 (≠ DI 33:34) binding
- ADV 74:76 (≠ ADA 60:62) binding
- R148 (≠ Q133) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- V158 (≠ S143) to L: in a breast cancer sample; somatic mutation
- Y169 (= Y154) mutation to A: Strongly reduced NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- YAASK 169:173 (≠ YSAAK 154:158) binding
- K173 (= K158) mutation to A: Abolishes NADH-dependent reductase activity with acetoacetyl-CoA. Strongly reduced NADH-dependent reductase activity with 9,10-phenanthrene quinone. Slightly decreases NADPH-dependent reductase activity with acetoacetyl-CoA, but increases NADPH-dependent reductase activity with 9,10-phenanthrene quinone. No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- R189 (≠ E174) mutation to E: No effect on the ability to restore growth of an OAR1-deficient yeast mutant.
- IAT 202:204 (≠ LKS 188:190) binding
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
33% identity, 98% coverage: 5:258/259 of query aligns to 4:239/239 of 3sj7A
- active site: G12 (≠ T13), S138 (= S141), Q148 (≠ N151), Y151 (= Y154), K155 (= K158)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G9), S10 (≠ G11), R11 (≠ Q12), I13 (≠ L14), N31 (≠ V32), Y32 (≠ D33), A33 (≠ I34), G34 (≠ Q35), S35 (= S36), A58 (= A60), N59 (≠ D61), V60 (≠ A62), N86 (≠ S88), A87 (= A89), T109 (≠ V111), S138 (= S141), Y151 (= Y154), K155 (= K158), P181 (≠ L184), G182 (= G185)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
33% identity, 99% coverage: 2:258/259 of query aligns to 5:239/240 of 4dmmB
- active site: G16 (≠ T13), S142 (= S141), Q152 (≠ N151), Y155 (= Y154), K159 (= K158)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G9), S14 (≠ G11), R15 (≠ Q12), G16 (≠ T13), I17 (≠ L14), A37 (≠ Q35), S38 (= S36), S39 (≠ D37), A62 (= A60), D63 (= D61), V64 (≠ A62), N90 (≠ S88), A91 (= A89), L113 (≠ V111), I140 (= I139), S142 (= S141), Y155 (= Y154), K159 (= K158), P185 (= P191), G186 (≠ M192), I188 (= I206), T190 (≠ P208), M192 (≠ Q210)
1gegE Cryatal structure analysis of meso-2,3-butanediol dehydrogenase (see paper)
31% identity, 99% coverage: 1:257/259 of query aligns to 1:254/256 of 1gegE
- active site: G13 (≠ T13), S139 (= S141), Y152 (= Y154), K156 (= K158), V197 (≠ Y200)
- binding alpha-D-glucopyranose: R63 (≠ E65), D64 (≠ Q66), F67 (≠ L69), E123 (≠ R125)
- binding nicotinamide-adenine-dinucleotide: G9 (= G9), Q12 (= Q12), I14 (≠ L14), D33 (= D33), Y34 (≠ I34), V58 (≠ F58), D59 (= D61), V60 (≠ A62), N86 (≠ S88), A87 (= A89), I109 (≠ V111), S139 (= S141), Y152 (= Y154), K156 (= K158), P182 (≠ L184), V185 (≠ L188), T187 (≠ S190), M189 (= M192)
7x5jC Acp-dependent oxoacyl reductase
35% identity, 99% coverage: 3:259/259 of query aligns to 5:254/256 of 7x5jC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G9), S13 (≠ G11), G15 (≠ T13), L16 (= L14), N36 (≠ I34), R37 (≠ Q35), N38 (≠ S36), D62 (= D61), V63 (≠ A62), N89 (≠ S88), A90 (= A89), A91 (vs. gap), V114 (= V111), I141 (= I139), Y156 (= Y154), K160 (= K158), L186 (= L184), G187 (= G185), V188 (≠ N186), R194 (≠ M192), S197 (= S195), S198 (≠ L196)
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
32% identity, 99% coverage: 2:258/259 of query aligns to 8:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G9), R18 (≠ Q12), G19 (≠ T13), I20 (≠ L14), D39 (= D33), R40 (vs. gap), C63 (≠ A60), I65 (≠ A62), N91 (≠ S88), G93 (= G90), I94 (= I91), V114 (= V111), Y155 (= Y154), K159 (= K158), I188 (≠ L188), T190 (≠ S190), T193 (≠ F193)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
28% identity, 99% coverage: 3:259/259 of query aligns to 9:247/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G9), S17 (≠ G11), R18 (≠ Q12), I20 (≠ L14), T40 (≠ K38), N62 (≠ D61), V63 (≠ A62), N89 (≠ S88), A90 (= A89), I92 (= I91), V139 (≠ I139), S141 (= S141), Y154 (= Y154), K158 (= K158), P184 (≠ L184), G185 (= G185), I187 (≠ L188), T189 (≠ S190), M191 (= M192)
Q9L9F8 Short-chain reductase protein NovJ; Novobiocin biosynthesis protein J; EC 1.1.1.- from Streptomyces niveus (Streptomyces spheroides) (see paper)
34% identity, 98% coverage: 2:256/259 of query aligns to 16:261/262 of Q9L9F8
- S152 (= S141) mutation to A: 2-3-fold decrease in beta-ketotyrosine product formation.
- Y164 (= Y154) mutation to F: 50-fold reduction in catalytic activity.
- K168 (= K158) mutation to I: Does not alter the catalytic turnover.
3ak4A Crystal structure of nadh-dependent quinuclidinone reductase from agrobacterium tumefaciens
31% identity, 98% coverage: 5:258/259 of query aligns to 10:257/258 of 3ak4A
- active site: G18 (≠ T13), S141 (= S141), L151 (≠ N151), Y154 (= Y154), K158 (= K158), E199 (≠ Y200)
- binding nicotinamide-adenine-dinucleotide: K17 (≠ Q12), G18 (≠ T13), I19 (≠ L14), D38 (= D33), L39 (≠ I34), V60 (≠ A60), D61 (= D61), V62 (≠ A62), N88 (≠ S88), A89 (= A89), G90 (= G90), T139 (≠ I139), S141 (= S141), Y154 (= Y154), K158 (= K158), G185 (= G185), V187 (≠ L188), T189 (≠ S190), M191 (= M192)
Q9LBG2 Levodione reductase; (6R)-2,2,6-trimethyl-1,4-cyclohexanedione reductase; EC 1.1.1.- from Leifsonia aquatica (Corynebacterium aquaticum) (see paper)
30% identity, 98% coverage: 2:256/259 of query aligns to 13:263/267 of Q9LBG2
- 17:42 (vs. 6:31, 38% identical) binding
- E103 (vs. gap) mutation E->A,D,N,Q: 26-fold increase in Km and a much lower enantiomeric excess of the reaction products.
1iy8A Crystal structure of levodione reductase (see paper)
30% identity, 98% coverage: 2:256/259 of query aligns to 4:254/258 of 1iy8A
- active site: G15 (≠ T13), S143 (= S141), Q153 (≠ N151), Y156 (= Y154), K160 (= K158)
- binding nicotinamide-adenine-dinucleotide: G11 (= G9), S14 (≠ Q12), G15 (≠ T13), L16 (= L14), D35 (= D33), V36 (≠ I34), A62 (= A55), D63 (= D61), V64 (≠ A62), N90 (≠ S88), G92 (= G90), I93 (= I91), T141 (≠ I139), S143 (= S141), Y156 (= Y154), K160 (= K158), P186 (≠ L184), G187 (= G185), T191 (≠ S190), P192 (= P191), M193 (= M192)
Query Sequence
>16789 FitnessBrowser__Keio:16789
MNQVAVVIGGGQTLGAFLCHGLAAEGYRVAVVDIQSDKAANVAQEINAEYGESMAYGFGA
DATSEQSVLALSRGVDEIFGRVDLLVYSAGIAKAAFISDFQLGDFDRSLQVNLVGYFLCA
REFSRLMIRDGIQGRIIQINSKSGKVGSKHNSGYSAAKFGGVGLTQSLALDLAEYGITVH
SLMLGNLLKSPMFQSLLPQYATKLGIKPDQVEQYYIDKVPLKRGCDYQDVLNMLLFYASP
KASYCTGQSINVTGGQVMF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory