SitesBLAST
Comparing 16820 FitnessBrowser__Keio:16820 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5je8B The crystal structure of bacillus cereus 3-hydroxyisobutyrate dehydrogenase in complex with NAD (see paper)
31% identity, 93% coverage: 9:290/302 of query aligns to 6:287/294 of 5je8B
3w6zA Crystal structure of NADP bound l-serine 3-dehydrogenase (k170m) from hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
31% identity, 92% coverage: 4:281/302 of query aligns to 11:286/296 of 3w6zA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G13), L21 (= L14), G22 (= G15), I23 (≠ S16), M24 (= M17), N43 (≠ D36), R44 (≠ L37), T45 (≠ N38), K48 (≠ A41), V77 (= V71), S78 (≠ V72), D82 (≠ Q76), Q85 (= Q79), V133 (= V127), F244 (≠ S239), K245 (≠ A240), H248 (≠ I243), K251 (= K246)
3ws7A The 1.18 a resolution structure of l-serine 3-dehydrogenase complexed with NADP+ and sulfate ion from the hyperthermophilic archaeon pyrobaculum calidifontis (see paper)
31% identity, 92% coverage: 4:281/302 of query aligns to 11:283/293 of 3ws7A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G13), L21 (= L14), G22 (= G15), I23 (≠ S16), M24 (= M17), N43 (≠ D36), R44 (≠ L37), T45 (≠ N38), K48 (≠ A41), M76 (≠ L70), V77 (= V71), S78 (≠ V72), D82 (≠ Q76), Q85 (= Q79), V133 (= V127), F241 (≠ S239), K242 (≠ A240), H245 (≠ I243), K248 (= K246)
- binding sulfate ion: T134 (≠ S128), G135 (= G129), K183 (= K178)
6smyA Crystal structure of sla reductase yihu from e. Coli with nadh and product dhps
30% identity, 95% coverage: 9:296/302 of query aligns to 3:292/294 of 6smyA
6smzC Crystal structure of sla reductase yihu from e. Coli in complex with nadh
30% identity, 95% coverage: 9:296/302 of query aligns to 3:292/295 of 6smzC
- binding nicotinamide-adenine-dinucleotide: G9 (= G15), Q10 (≠ S16), M11 (= M17), F29 (≠ A35), D30 (= D36), V31 (≠ L37), M63 (≠ L70), L64 (≠ V71), V73 (= V80), S94 (= S101), T95 (= T102), R122 (≠ G129)
P0A9V8 3-sulfolactaldehyde reductase; SLA reductase; 4-hydroxybutyrate dehydrogenase; Gamma-hydroxybutyrate dehydrogenase; GHBDH; Succinic semialdehyde reductase; SSA reductase; EC 1.1.1.373; EC 1.1.1.61 from Escherichia coli (strain K12)
30% identity, 95% coverage: 9:296/302 of query aligns to 4:293/298 of P0A9V8
- QM 11:12 (≠ SM 16:17) binding
- D31 (= D36) binding
- L65 (≠ V71) binding
- T96 (= T102) binding
- G122 (≠ S128) mutation to S: 25-fold decrease in catalytic efficiency with SLA as substrate. 5-fold decrease in catalytic efficiency with NADH as substrate.
- R123 (≠ G129) binding ; mutation to G: 130-fold decrease in catalytic efficiency with SLA as substrate. 3-fold decrease in catalytic efficiency with NADH as substrate.
- T124 (≠ G130) mutation to G: 230-fold decrease in catalytic efficiency with SLA as substrate. 12-fold decrease in catalytic efficiency with NADH as substrate.
- NNYMS 174:178 (≠ HQLLA 181:185) binding
- K240 (= K246) binding
P29266 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Rattus norvegicus (Rat) (see paper)
29% identity, 95% coverage: 5:290/302 of query aligns to 37:327/335 of P29266
- D68 (= D36) mutation to R: Decrease of activity with NAD, increase of activity with NADP.
- K208 (= K178) mutation K->A,H,N,R: Complete loss of activity.
- N212 (≠ Q182) mutation to Q: Decrease in activity.
2i9pB Crystal structure of human hydroxyisobutyrate dehydrogenase complexed with NAD+
29% identity, 94% coverage: 9:292/302 of query aligns to 3:291/296 of 2i9pB
- binding nicotinamide-adenine-dinucleotide: G9 (= G15), N10 (≠ S16), M11 (= M17), Y29 (≠ A35), D30 (= D36), V31 (≠ L37), M63 (≠ L70), L64 (≠ V71), P65 (≠ V72), T95 (= T102), V120 (= V127), G122 (= G129), F238 (≠ S239), K245 (= K246)
P31937 3-hydroxyisobutyrate dehydrogenase, mitochondrial; HIBADH; EC 1.1.1.31 from Homo sapiens (Human) (see paper)
29% identity, 95% coverage: 5:292/302 of query aligns to 38:330/336 of P31937
- 40:68 (vs. 7:35, 31% identical) binding
- LP 103:104 (≠ VV 71:72) binding
- N108 (≠ Q76) binding
- T134 (= T102) binding
- K284 (= K246) binding
Sites not aligning to the query:
- 1:36 modified: transit peptide, Mitochondrion
3pefA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter metallireducens in complex with NADP+ (see paper)
28% identity, 94% coverage: 10:293/302 of query aligns to 5:286/287 of 3pefA
- binding glycerol: D67 (≠ N73), G123 (= G129), K171 (= K178), N175 (≠ Q182), M178 (≠ A185), L203 (≠ Y210), G207 (≠ T214), N213 (≠ S220), A217 (≠ E224), F232 (≠ S239), H236 (≠ I243), K239 (= K246), R242 (≠ G249), R269 (≠ S276)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G15), I11 (≠ S16), M12 (= M17), N31 (≠ D36), R32 (≠ L37), S33 (≠ N38), K36 (≠ A41), M64 (≠ L70), L65 (≠ V71), A66 (≠ V72), A70 (≠ Q76), E73 (≠ Q79), T96 (= T102), V121 (= V127), G123 (= G129), S124 (≠ G130), A231 (≠ H238), F232 (≠ S239), H236 (≠ I243), K239 (= K246)
3pduA Crystal structure of gamma-hydroxybutyrate dehydrogenase from geobacter sulfurreducens in complex with NADP+ (see paper)
29% identity, 94% coverage: 10:293/302 of query aligns to 5:286/287 of 3pduA
- binding glycerol: R242 (≠ G249), E246 (≠ D253), E246 (≠ D253), R250 (≠ A257)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G13), G10 (= G15), I11 (≠ S16), M12 (= M17), N31 (≠ D36), R32 (≠ L37), N33 (= N38), M64 (≠ L70), L65 (≠ V71), A66 (≠ V72), A70 (≠ Q76), T96 (= T102), V121 (= V127), G123 (= G129), T124 (≠ G130), K171 (= K178), S231 (≠ H238), F232 (≠ S239), P233 (≠ A240), H236 (≠ I243), K239 (= K246)
Q8T079 Cytokine-like nuclear factor N-PAC; NPAC; Glyoxylate reductase 1 homolog; Nuclear protein NP60 homolog; Nucleosome-destabilizing factor; Putative oxidoreductase GLYR1 homolog from Drosophila melanogaster (Fruit fly) (see paper)
28% identity, 94% coverage: 5:289/302 of query aligns to 314:597/602 of Q8T079
Sites not aligning to the query:
- 8 modified: Phosphoserine
- 10 modified: Phosphoserine
- 224 modified: Phosphoserine
- 228 modified: Phosphoserine
- 243 modified: Phosphoserine
Q9I5I6 NAD-dependent L-serine dehydrogenase; L-serine 3-dehydrogenase (NAD(+)); EC 1.1.1.387 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
31% identity, 94% coverage: 8:292/302 of query aligns to 3:292/298 of Q9I5I6
- P66 (≠ V72) binding
- T96 (= T102) binding ; mutation to A: Almost abolished activity.
- S122 (= S128) mutation to A: Strongly reduced activity.
- K171 (= K178) active site
- N175 (≠ Q182) mutation to A: Strongly reduced activity.
- W214 (= W221) mutation to A: Almost abolished activity.
- Y219 (vs. gap) mutation to A: Strongly reduced activity.
- K246 (= K246) binding ; mutation to A: Almost abolished activity.
- D247 (= D247) mutation to A: Almost abolished activity.
Sites not aligning to the query:
3q3cA Crystal structure of a serine dehydrogenase from pseudomonas aeruginosa pao1 in complex with NAD (see paper)
32% identity, 94% coverage: 8:292/302 of query aligns to 2:290/294 of 3q3cA
- binding nicotinamide-adenine-dinucleotide: G9 (= G15), H10 (≠ S16), M11 (= M17), F29 (≠ A35), D30 (= D36), L31 (= L37), M63 (≠ V71), L64 (≠ V72), P65 (≠ N73), T94 (= T102), V119 (= V127), G121 (= G129), F237 (≠ S239), K244 (= K246)
2uyyA Structure of the cytokine-like nuclear factor n-pac
23% identity, 96% coverage: 3:292/302 of query aligns to 3:290/292 of 2uyyA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: G15 (= G15), L16 (≠ S16), M17 (= M17), N36 (≠ D36), R37 (≠ L37), T38 (≠ N38), V70 (= V71), S71 (≠ V72), A75 (≠ Q76), T101 (= T102), F237 (≠ S239), Y238 (≠ A240), Y241 (≠ I243), K244 (= K246)
Q49A26 Cytokine-like nuclear factor N-PAC; NPAC; 3-hydroxyisobutyrate dehydrogenase-like protein; Glyoxylate reductase 1 homolog; Nuclear protein NP60; Nuclear protein of 60 kDa; Nucleosome-destabilizing factor; hNDF; Putative oxidoreductase GLYR1 from Homo sapiens (Human) (see 3 papers)
23% identity, 96% coverage: 3:292/302 of query aligns to 264:551/553 of Q49A26
- 271:285 (vs. 10:24, 47% identical) binding
- T362 (= T102) binding
- M437 (≠ K178) mutation to K: Loss of tetramerization and protein stability.; mutation to N: No effect on tetramerization or protein stability.
- P496 (= P237) to L: decreased interaction with GATA4; decreased synergistic activation of GATA4 target genes transcription; detrimental effect on cardiomyocyte differentiation
- K505 (= K246) binding
Sites not aligning to the query:
- 214 D→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 214:217 Interaction with histone H3
- 216 H→A: Slightly reduced stimulation of KDM1B demethylase activity, but normal KDM1B-binding.
- 216:225 Interaction with KDM1B
- 217 Required to promote KDM1B demethylase activity toward histone H3K4me1 and H3K4me2; F→A: Abolished stimulation of KDM1B demethylase activity, reduced affinity for histone H3 of the dimer with KDM1B, but normal KDM1B-binding.
- 219 H→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-223.
- 220:222 FLL→AAA: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity.
- 223 S→A: Impaired KDM1B-binding and abolished stimulation of KDM1B demethylase activity; when associated with A-219.
5y8lB Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD +(s)-3-hydroxyisobutyrate (s-hiba) (see paper)
30% identity, 93% coverage: 9:289/302 of query aligns to 4:285/290 of 5y8lB
- binding (2~{S})-2-methylpentanedioic acid: T129 (≠ E138), E149 (= E158), A152 (= A161), G153 (= G162), G153 (= G162), K154 (= K163)
- binding (2S)-2-methyl-3-oxidanyl-propanoic acid: S119 (= S128), G120 (= G129), W211 (= W221), F236 (≠ S239)
- binding nicotinamide-adenine-dinucleotide: G8 (= G13), G10 (= G15), N11 (≠ S16), M12 (= M17), F30 (≠ A35), D31 (= D36), P32 (≠ L37), M64 (≠ L70), L65 (≠ V71), T93 (= T102), G121 (= G130), K168 (= K178), L240 (≠ I243), K243 (= K246)
5y8kA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + l-serine (see paper)
30% identity, 93% coverage: 9:289/302 of query aligns to 4:285/290 of 5y8kA
5y8hA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + NAD+ (see paper)
30% identity, 93% coverage: 9:289/302 of query aligns to 3:284/291 of 5y8hA
- binding (2~{S})-2-methylpentanedioic acid: R144 (≠ A154), E148 (= E158), A151 (= A161), K153 (= K163)
- binding nicotinamide-adenine-dinucleotide: G7 (= G13), G9 (= G15), N10 (≠ S16), M11 (= M17), F29 (≠ A35), D30 (= D36), P31 (≠ L37), M63 (≠ L70), L64 (≠ V71), G120 (= G130), L239 (≠ I243), K242 (= K246)
5y8iA Mycobacterium tuberculosis 3-hydroxyisobutyrate dehydrogenase (mthibadh) + (s)-3-hydroxyisobutyrate (s-hiba) (see paper)
30% identity, 93% coverage: 9:289/302 of query aligns to 3:284/292 of 5y8iA
Query Sequence
>16820 FitnessBrowser__Keio:16820
MKTGSEFHVGIVGLGSMGMGAALSYVRAGLSTWGADLNSNACATLKEAGACGVSDNAATF
AEKLDALLVLVVNAAQVKQVLFGETGVAQHLKPGTAVMVSSTIASADAQEIATALAGFDL
EMLDAPVSGGAVKAANGEMTVMASGSDIAFERLAPVLEAVAGKVYRIGAEPGLGSTVKII
HQLLAGVHIAAGAEAMALAARAGIPLDVMYDVVTNAAGNSWMFENRMRHVVDGDYTPHSA
VDIFVKDLGLVADTAKALHFPLPLASTALNMFTSASNAGYGKEDDSAVIKIFSGITLPGA
KS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory