SitesBLAST
Comparing 16858 FitnessBrowser__Keio:16858 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4za2D Crystal structure of pectobacterium carotovorum 2-keto-3-deoxy-d- gluconate dehydrogenase complexed with NAD+ (see paper)
41% identity, 96% coverage: 11:261/261 of query aligns to 3:247/247 of 4za2D
- binding nicotinamide-adenine-dinucleotide: G17 (= G25), D19 (≠ N27), L22 (= L30), I42 (≠ F50), D65 (≠ G74), M66 (≠ I75), N92 (= N101), A93 (= A102), G94 (= G103), L115 (≠ V124), I143 (= I151), S145 (= S153), Y158 (= Y166), K162 (= K170), G189 (= G197), M191 (≠ Y199), T193 (= T201), N195 (≠ I203)
4hp8B Crystal structure of a putative 2-deoxy-d-gluconate 3-dehydrogenase from agrobacterium tumefaciens (target efi-506435) with bound NADP
43% identity, 95% coverage: 14:261/261 of query aligns to 4:246/246 of 4hp8B
- active site: G19 (= G29), S138 (= S153), V148 (≠ S163), Y151 (= Y166), K155 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G25), N17 (= N27), T18 (≠ S28), G19 (= G29), L20 (= L30), R40 (≠ V51), R41 (≠ K52), D63 (≠ G74), F64 (≠ I75), N85 (= N101), G87 (= G103), I88 (= I104), I136 (= I151), Y151 (= Y166), K155 (= K170), P181 (= P196), G182 (= G197), I184 (≠ Y199), T186 (= T201), N188 (≠ I203), T189 (= T204)
3o03A Quaternary complex structure of gluconate 5-dehydrogenase from streptococcus suis type 2 (see paper)
43% identity, 96% coverage: 9:259/261 of query aligns to 2:247/254 of 3o03A
- active site: G22 (= G29), S147 (= S153), V157 (≠ S163), Y160 (= Y166), K164 (= K170)
- binding calcium ion: S147 (= S153), M148 (≠ L154), P190 (= P196)
- binding D-gluconic acid: I99 (≠ C105), R101 (≠ L107), S147 (= S153), M149 (≠ F155), R154 (≠ G160), Y160 (= Y166)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G18 (= G25), Y21 (≠ S28), G22 (= G29), I23 (≠ L30), D42 (≠ G55), I43 (≠ E56), L47 (≠ M60), D68 (≠ G74), V69 (≠ I75), N95 (= N101), A96 (= A102), G97 (= G103), I145 (= I151), Y160 (= Y166), K164 (= K170), P190 (= P196)
4jroC Crystal structure of 3-oxoacyl-[acyl-carrier protein]reductase (fabg) from listeria monocytogenes in complex with NADP+
38% identity, 95% coverage: 14:260/261 of query aligns to 1:247/247 of 4jroC
- active site: G16 (= G29), S142 (= S153), Q152 (≠ S163), Y155 (= Y166), K159 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G25), S14 (≠ N27), R15 (≠ S28), G16 (= G29), I17 (≠ L30), N35 (vs. gap), Y36 (vs. gap), N37 (vs. gap), G38 (vs. gap), S39 (vs. gap), N63 (≠ G74), V64 (≠ I75), N90 (= N101), A91 (= A102), I93 (= I104), I113 (≠ V124), S142 (= S153), Y155 (= Y166), K159 (= K170), P185 (= P196), I188 (≠ Y199), T190 (= T201)
3uf0A Crystal structure of a putative NAD(p) dependent gluconate 5- dehydrogenase from beutenbergia cavernae(efi target efi-502044) with bound NADP (low occupancy)
38% identity, 94% coverage: 14:259/261 of query aligns to 3:247/249 of 3uf0A
- active site: G18 (= G29), S141 (= S153), V151 (≠ S163), Y154 (= Y166), K158 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G25), S17 (= S28), G18 (= G29), I19 (≠ L30), R39 (≠ F50), D63 (≠ G74), L64 (≠ I75), N89 (= N101), G91 (= G103), I92 (= I104), I139 (= I151), A140 (≠ C152), S141 (= S153), Y154 (= Y166), K158 (= K170), P184 (= P196), G185 (= G197), V187 (≠ Y199), T189 (= T201), N191 (≠ I203), T192 (= T204)
5u9pB Crystal structure of a gluconate 5-dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP and tartrate
38% identity, 95% coverage: 10:257/261 of query aligns to 8:256/261 of 5u9pB
- active site: G27 (= G29), S152 (= S153), Y165 (= Y166), K169 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G23 (= G25), R26 (≠ S28), G27 (= G29), I28 (≠ L30), R48 (≠ F50), D73 (≠ G74), V74 (≠ I75), N100 (= N101), A101 (= A102), I150 (= I151), Y165 (= Y166), K169 (= K170), P195 (= P196), F198 (≠ Y199), T200 (= T201), L202 (≠ I203), N203 (≠ T204)
3op4A Crystal structure of putative 3-ketoacyl-(acyl-carrier-protein) reductase from vibrio cholerae o1 biovar eltor str. N16961 in complex with NADP+ (see paper)
34% identity, 95% coverage: 13:260/261 of query aligns to 3:247/247 of 3op4A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G15 (= G25), S17 (≠ N27), R18 (≠ S28), I20 (≠ L30), T40 (vs. gap), N62 (≠ G74), V63 (≠ I75), N89 (= N101), A90 (= A102), I92 (= I104), V139 (≠ I151), S141 (= S153), Y154 (= Y166), K158 (= K170), P184 (= P196), G185 (= G197), I187 (≠ Y199), T189 (= T201), M191 (≠ I203)
1vl8B Crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution
37% identity, 94% coverage: 14:258/261 of query aligns to 2:249/252 of 1vl8B
- active site: G17 (= G29), S143 (= S153), I154 (≠ S163), Y157 (= Y166), K161 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G25), R16 (≠ S28), G17 (= G29), L18 (= L30), S37 (= S49), R38 (vs. gap), C63 (≠ V73), D64 (≠ G74), V65 (≠ I75), A91 (≠ N101), A92 (= A102), G93 (= G103), I94 (= I104), V114 (= V124), I141 (= I151), S143 (= S153), Y157 (= Y166), K161 (= K170), P187 (= P196), G188 (= G197), Y190 (= Y199), T192 (= T201), M194 (≠ I203), T195 (= T204)
4i08A Crystal structure of beta-ketoacyl-acyl carrier protein reductase (fabg) from vibrio cholerae in complex with NADPH (see paper)
33% identity, 95% coverage: 13:260/261 of query aligns to 3:243/243 of 4i08A
- active site: G19 (= G29), N113 (= N125), S141 (= S153), Q151 (≠ S163), Y154 (= Y166), K158 (= K170)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G15 (= G25), S17 (≠ N27), R18 (≠ S28), I20 (≠ L30), T40 (vs. gap), N62 (≠ G74), V63 (≠ I75), N89 (= N101), A90 (= A102), G140 (≠ C152), S141 (= S153), Y154 (= Y166), K158 (= K170), P184 (= P196), G185 (= G197), T189 (= T201)
4dmmB 3-oxoacyl-[acyl-carrier-protein] reductase from synechococcus elongatus pcc 7942 in complex with NADP
36% identity, 95% coverage: 14:260/261 of query aligns to 1:239/240 of 4dmmB
- active site: G16 (= G29), S142 (= S153), Q152 (≠ S163), Y155 (= Y166), K159 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G25), S14 (≠ N27), R15 (≠ S28), G16 (= G29), I17 (≠ L30), A37 (≠ P48), S38 (= S49), S39 (≠ F50), A62 (≠ V73), D63 (≠ G74), V64 (≠ I75), N90 (= N101), A91 (= A102), L113 (≠ V124), I140 (= I151), S142 (= S153), Y155 (= Y166), K159 (= K170), P185 (= P196), G186 (= G197), I188 (≠ Y199), T190 (= T201), M192 (≠ I203)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
34% identity, 95% coverage: 14:260/261 of query aligns to 1:244/244 of P0A2C9
- M125 (= M140) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A240) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (= S241) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
3osuA Crystal structure of the 3-oxoacyl-acyl carrier protein reductase, fabg, from staphylococcus aureus
34% identity, 92% coverage: 19:257/261 of query aligns to 5:243/246 of 3osuA
7tzpG Crystal structure of putataive short-chain dehydrogenase/reductase (fabg) from klebsiella pneumoniae subsp. Pneumoniae ntuh-k2044 in complex with nadh (see paper)
37% identity, 95% coverage: 14:260/261 of query aligns to 4:247/247 of 7tzpG
- binding 1,4-dihydronicotinamide adenine dinucleotide: G15 (= G25), R18 (≠ S28), G19 (= G29), I20 (≠ L30), D39 (≠ S49), R40 (≠ F50), C63 (≠ V73), I65 (= I75), N91 (= N101), G93 (= G103), I94 (= I104), V114 (= V124), Y155 (= Y166), K159 (= K170), I188 (≠ Y199), T190 (= T201), T193 (= T207)
1edoA The x-ray structure of beta-keto acyl carrier protein reductase from brassica napus complexed with NADP+ (see paper)
32% identity, 92% coverage: 22:260/261 of query aligns to 5:244/244 of 1edoA
- active site: G12 (= G29), S138 (= S153), Y151 (= Y166), K155 (= K170)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G25), S10 (≠ N27), R11 (≠ S28), I13 (≠ L30), N31 (vs. gap), Y32 (vs. gap), A33 (≠ P48), R34 (≠ S49), S35 (≠ F50), D59 (≠ G74), V60 (≠ I75), N86 (= N101), A87 (= A102), S138 (= S153), Y151 (= Y166), K155 (= K170), P181 (= P196), G182 (= G197), I184 (≠ Y199), S186 (≠ T201), M188 (≠ I203)
3sj7A Structure of beta-ketoacetyl-coa reductase (fabg) from staphylococcus aureus complex with NADPH (see paper)
34% identity, 92% coverage: 19:257/261 of query aligns to 2:236/239 of 3sj7A
- active site: G12 (= G29), S138 (= S153), Q148 (≠ S163), Y151 (= Y166), K155 (= K170)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G25), S10 (≠ N27), R11 (≠ S28), I13 (≠ L30), N31 (≠ P48), Y32 (vs. gap), A33 (≠ S49), G34 (≠ F50), S35 (≠ V51), A58 (≠ V73), N59 (≠ G74), V60 (≠ I75), N86 (= N101), A87 (= A102), T109 (≠ V124), S138 (= S153), Y151 (= Y166), K155 (= K170), P181 (= P196), G182 (= G197)
P0AEK2 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Escherichia coli (strain K12) (see 2 papers)
33% identity, 95% coverage: 14:260/261 of query aligns to 1:244/244 of P0AEK2
- GASR 12:15 (≠ GGNS 25:28) binding
- T37 (≠ V51) binding
- NV 59:60 (≠ GI 74:75) binding
- N86 (= N101) binding
- Y151 (= Y166) mutation to F: Defect in the affinity for NADPH.
- YAAAK 151:155 (≠ YSATK 166:170) binding
- A154 (≠ T169) mutation to T: Decreases in the thermolability of the reductase; when associated with K-233.
- K155 (= K170) mutation to A: Defect in the affinity for NADPH.
- I184 (≠ Y199) binding
- E233 (≠ H250) mutation to K: Decreases in the thermolability of the reductase; when associated with T-154.
1q7bA The structure of betaketoacyl-[acp] reductase from e. Coli in complex with NADP+ (see paper)
34% identity, 94% coverage: 15:260/261 of query aligns to 1:243/243 of 1q7bA
- active site: G15 (= G29), E101 (≠ D117), S137 (= S153), Q147 (≠ S163), Y150 (= Y166), K154 (= K170)
- binding calcium ion: E232 (≠ H250), T233 (≠ L251)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G25), S13 (≠ N27), R14 (≠ S28), T36 (≠ V51), N58 (≠ G74), V59 (≠ I75), N85 (= N101), A86 (= A102), G87 (= G103), I88 (= I104), S137 (= S153), Y150 (= Y166), K154 (= K170), P180 (= P196), G181 (= G197), I183 (≠ Y199)
7do7A Crystal structure of azotobacter vinelandii l-rhamnose 1- dehydrogenase(NAD and l-rhamnose bound-form) (see paper)
35% identity, 93% coverage: 19:260/261 of query aligns to 6:253/256 of 7do7A
- active site: G16 (= G29), S146 (= S153), Y159 (= Y166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G25), R15 (≠ S28), G16 (= G29), I17 (≠ L30), S37 (≠ F50), D66 (≠ E78), A67 (≠ G79), N93 (= N101), A94 (= A102), G95 (= G103), I96 (= I104), V144 (≠ I151), S145 (≠ C152), S146 (= S153), Y159 (= Y166), K163 (= K170), P189 (= P196), G190 (= G197), I192 (≠ Y199), T194 (= T201), I196 (= I203)
- binding beta-L-rhamnopyranose: F99 (≠ L107), S146 (= S153), S148 (≠ F155), Q156 (≠ S163), Y159 (= Y166), N197 (≠ T204), D235 (≠ P242), M236 (≠ A243), R238 (≠ N245)
7b81A Crystal structure of azotobacter vinelandii l-rhamnose 1-dehydrogenase (NAD bound-form) (see paper)
35% identity, 93% coverage: 19:260/261 of query aligns to 6:253/256 of 7b81A
- active site: G16 (= G29), S146 (= S153), Y159 (= Y166)
- binding nicotinamide-adenine-dinucleotide: G12 (= G25), S14 (≠ N27), R15 (≠ S28), I17 (≠ L30), D66 (≠ E78), A67 (≠ G79), N93 (= N101), A94 (= A102), G95 (= G103), I96 (= I104), T116 (≠ V124), V144 (≠ I151), S146 (= S153), Y159 (= Y166), K163 (= K170), P189 (= P196), G190 (= G197), I192 (≠ Y199), T194 (= T201), I196 (= I203)
1q7cA The structure of betaketoacyl-[acp] reductase y151f mutant in complex with NADPH fragment (see paper)
33% identity, 94% coverage: 15:260/261 of query aligns to 1:243/243 of 1q7cA
- active site: G15 (= G29), S137 (= S153), Q147 (≠ S163), F150 (≠ Y166), K154 (= K170)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G25), S13 (≠ N27), R14 (≠ S28), A35 (≠ F50), T36 (≠ V51), L57 (≠ V73), N58 (≠ G74), V59 (≠ I75), G87 (= G103), I88 (= I104)
Query Sequence
>16858 FitnessBrowser__Keio:16858
MSIESLNAFSMDFFSLKGKTAIVTGGNSGLGQAFAMALAKAGANIFIPSFVKDNGETKEM
IEKQGVEVDFMQVGITAEGAPQKIIAACCERFGTVDILVNNAGICKLNKVLDFGRADWDP
MIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWSPAYSATKHALAGFTKAY
CDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLDHIPANRWGDTQDLMGAAVFLA
SPASNYVNGHLLVVDGGYLVR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory