Comparing 16886 FitnessBrowser__Keio:16886 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 8 hits to proteins with known functional sites (download)
1fuiA L-fucose isomerase from escherichia coli (see paper)
100% identity, 100% coverage: 1:591/591 of query aligns to 1:591/591 of 1fuiA
P69922 L-fucose isomerase; FucIase; FucIso; 6-deoxy-L-galactose isomerase; D-arabinose isomerase; EC 5.3.1.25; EC 5.3.1.3 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:591/591 of query aligns to 1:591/591 of P69922
3a9tA X-ray structure of bacillus pallidus d-arabinose isomerase complex with l-fucitol (see paper)
64% identity, 98% coverage: 5:583/591 of query aligns to 9:587/589 of 3a9tA
3a9sA X-ray structure of bacillus pallidus d-arabinose isomerase complex with glycerol (see paper)
64% identity, 98% coverage: 5:583/591 of query aligns to 9:587/589 of 3a9sA
3a9rA X-ray structures of bacillus pallidus d-arabinose isomerasecomplex with (4r)-2-methylpentane-2,4-diol (see paper)
64% identity, 98% coverage: 5:583/591 of query aligns to 9:587/589 of 3a9rA
4c20B L-fucose isomerase (see paper)
61% identity, 100% coverage: 1:590/591 of query aligns to 16:605/605 of 4c20B
4c22A L-fucose isomerase in complex with fuculose (see paper)
61% identity, 99% coverage: 4:590/591 of query aligns to 1:587/587 of 4c22A
4c21A L-fucose isomerase in complex with fucitol (see paper)
61% identity, 99% coverage: 4:590/591 of query aligns to 1:587/587 of 4c21A
>16886 FitnessBrowser__Keio:16886
MKKISLPKIGIRPVIDGRRMGVRESLEEQTMNMAKATAALLTEKLRHACGAAVECVISDT
CIAGMAEAAACEEKFSSQNVGLTITVTPCWCYGSETIDMDPTRPKAIWGFNGTERPGAVY
LAAALAAHSQKGIPAFSIYGHDVQDADDTSIPADVEEKLLRFARAGLAVASMKGKSYLSL
GGVSMGIAGSIVDHNFFESWLGMKVQAVDMTELRRRIDQKIYDEAELEMALAWADKNFRY
GEDENNKQYQRNAEQSRAVLRESLLMAMCIRDMMQGNSKLADIGRVEESLGYNAIAAGFQ
GQRHWTDQYPNGDTAEAILNSSFDWNGVREPFVVATENDSLNGVAMLMGHQLTGTAQVFA
DVRTYWSPEAIERVTGHKLDGLAEHGIIHLINSGSAALDGSCKQRDSEGNPTMKPHWEIS
QQEADACLAATEWCPAIHEYFRGGGYSSRFLTEGGVPFTMTRVNIIKGLGPVLQIAEGWS
VELPKDVHDILNKRTNSTWPTTWFAPRLTGKGPFTDVYSVMANWGANHGVLTIGHVGADF
ITLASMLRIPVCMHNVEETKVYRPSAWAAHGMDIEGQDYRACQNYGPLYKR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory