Comparing 16887 b2803 L-fuculokinase (NCBI) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
24% identity, 95% coverage: 16:475/482 of query aligns to 5:467/478 of 5ya2A
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
26% identity, 95% coverage: 16:475/482 of query aligns to 1:459/485 of 6k76A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
24% identity, 95% coverage: 16:475/482 of query aligns to 5:467/478 of 5ya1A
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
27% identity, 84% coverage: 19:424/482 of query aligns to 5:401/476 of 2itmA
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
23% identity, 97% coverage: 16:481/482 of query aligns to 5:476/496 of P18157
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
26% identity, 84% coverage: 19:424/482 of query aligns to 5:409/484 of P09099
Q1R415 Rhamnulokinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain UTI89 / UPEC) (see paper)
26% identity, 78% coverage: 84:460/482 of query aligns to 74:451/489 of Q1R415
Sites not aligning to the query:
2uytA Structure of l-rhamnulose kinase in complex with adp and beta-l- rhamnulose. (see paper)
25% identity, 83% coverage: 84:482/482 of query aligns to 73:474/479 of 2uytA
Sites not aligning to the query:
2cglA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose, adp and a modeled atp gamma phosphate. (see paper)
25% identity, 83% coverage: 84:482/482 of query aligns to 73:474/479 of 2cglA
Sites not aligning to the query:
2cgjA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose and adp. (see paper)
25% identity, 83% coverage: 84:482/482 of query aligns to 73:474/479 of 2cgjA
Sites not aligning to the query:
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
22% identity, 98% coverage: 13:482/482 of query aligns to 2:478/495 of 6udeB
P32171 L-Rhamnulokinase; RhaB; RhuK; ATP:L-rhamnulose phosphotransferase; L-rhamnulose 1-kinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain K12) (see paper)
26% identity, 78% coverage: 84:460/482 of query aligns to 74:451/489 of P32171
Sites not aligning to the query:
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
23% identity, 94% coverage: 10:461/482 of query aligns to 1:462/501 of O34154
Q9NJP9 Glycerol kinase, glycosomal; GK; Glycerokinase; ATP:glycerol 3-phosphotransferase; EC 2.7.1.30 from Trypanosoma brucei brucei (see 2 papers)
26% identity, 63% coverage: 136:438/482 of query aligns to 131:450/512 of Q9NJP9
Sites not aligning to the query:
6jafA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with ppi (pyrophosphatase reaction)
26% identity, 63% coverage: 136:438/482 of query aligns to 133:452/513 of 6jafA
Sites not aligning to the query:
6j9qA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with amp-pnp.
26% identity, 63% coverage: 136:438/482 of query aligns to 133:452/513 of 6j9qA
5aziA Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with 4np (see paper)
26% identity, 63% coverage: 136:438/482 of query aligns to 133:452/513 of 5aziA
Sites not aligning to the query:
3wxlA Crystal structure of trypanosoma brucei gambiense glycerol kinase complex with adp, mg2+, and glycerol (see paper)
26% identity, 63% coverage: 136:438/482 of query aligns to 133:452/513 of 3wxlA
Sites not aligning to the query:
3wxjB Crystal structure of trypanosoma brucei gambiense glycerol kinase in complex with glycerol 3-phosphate (see paper)
26% identity, 63% coverage: 136:438/482 of query aligns to 133:452/513 of 3wxjB
Sites not aligning to the query:
5gn6A Crystal structure of glycerol kinase from trypanosoma brucei gambiense complexed with cumarin derivative-17b (see paper)
26% identity, 63% coverage: 136:438/482 of query aligns to 133:452/513 of 5gn6A
Sites not aligning to the query:
>16887 b2803 L-fuculokinase (NCBI)
MLSGYIAGAIMKQEVILVLDCGATNVRAIAVNRQGKIVARASTPNASDIAMENNTWHQWS
LDAILQRFADCCRQINSELTECHIRGIAVTTFGVDGALVDKQGNLLYPIISWKCPRTAAV
MDNIERLISAQRLQAISGVGAFSFNTLYKLVWLKENHPQLLERAHAWLFISSLINHRLTG
EFTTDITMAGTSQMLDIQQRDFSPQILQATGIPRRLFPRLVEAGEQIGTLQNSAAAMLGL
PVGIPVISAGHDTQFALFGAGAEQNEPVLSSGTWEILMVRSAQVDTSLLSQYAGSTCELD
SQAGLYNPGMQWLASGVLEWVRKLFWTAETPWQMLIEEARLIAPGADGVKMQCDLLSCQN
AGWQGVTLNTTRGHFYRAALEGLTAQLQRNLQMLEKIGHFKASELLLVGGGSRNTLWNQI
KANMLDIPVKVLDDAETTVAGAALFGWYGVGEFNSPEEARAQIHYQYRYFYPQTEPEFIE
EV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory