Comparing 17013 FitnessBrowser__Keio:17013 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
1j6tA Complex of enzyme iiamtl and the histidine-containing phosphocarrier protein hpr from escherichia coli nmr, restrained regularized mean structure (see paper)
29% identity, 88% coverage: 16:145/147 of query aligns to 13:142/144 of 1j6tA
P00550 PTS system mannitol-specific EIICBA component; EIICBA-Mtl; EII-Mtl; EC 2.7.1.197 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 97% coverage: 3:145/147 of query aligns to 482:634/637 of P00550
Sites not aligning to the query:
C0H3V2 Mannitol-specific phosphotransferase enzyme IIA component; EIIA; EIII; PTS system mannitol-specific EIIA component from Bacillus subtilis (strain 168) (see paper)
25% identity, 93% coverage: 11:146/147 of query aligns to 8:141/143 of C0H3V2
>17013 FitnessBrowser__Keio:17013
MRLSDYFPESSISVIHSAKDWQEAIDFSMVSLLDKNYISENYIQAIKDSTINNGPYYILA
PGVAMPHARPECGALKTGMSLTLLEQGVYFPGNDEPIKLLIGLSAADADSHIGAIQALSE
LLCEEEILEQLLTASSEKQLADIISRG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory