Comparing 17139 FitnessBrowser__Keio:17139 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q9FMF7 Dicarboxylate transporter 2.1, chloroplastic; AtpDCT1; Glutamate/malate translocator from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 94% coverage: 23:481/487 of query aligns to 113:556/563 of Q9FMF7
7t9gA Structure of vcindy-na+ (see paper)
24% identity, 76% coverage: 94:463/487 of query aligns to 71:425/445 of 7t9gA
6wtxA Structure of vcindy in complex with terephthalate (see paper)
24% identity, 76% coverage: 94:463/487 of query aligns to 71:425/445 of 6wtxA
6okzB Structure of vcindy bound to fumarate
24% identity, 76% coverage: 94:463/487 of query aligns to 70:424/444 of 6okzB
7jsjA Structure of the nact-pf2 complex (see paper)
25% identity, 54% coverage: 214:477/487 of query aligns to 175:451/468 of 7jsjA
Sites not aligning to the query:
>17139 FitnessBrowser__Keio:17139
MKPSTEWWRYLAPLAVIAIIALLPVPAGLENHTWLYFAVFTGVIVGLILEPVPGAVVAMV
GISIIAILSPWLLFSPEQLAQPGFKFTAKSLSWAVSGFSNSVIWLIFAAFMFGTGYEKTG
LGRRIALILVKKMGHRTLFLGYAVMFSELILAPVTPSNSARGAGIIYPIIRNLPPLYQSQ
PNDSSSRSIGSYIMWMGIVADCVTSAIFLTAMAPNLLLIGLMKSASHATLSWGDWFLGML
PLSILLVLLVPWLAYVLYPPVLKSGDQVPRWAETELQAMGPLCSREKRMLGLMVGALVLW
IFGGDYIDAAMVGYSVVALMLLLRIISWDDIVSNKAAWNVFFWLASLITLATGLNNTGFI
SWFGKLLAGSLSGYSPTMVMVALIVVFYLLRYFFASATAYTSALAPMMIAAALAMPEIPL
PVFCLMVGAAIGLGSILTPYATGPSPIYYGSGYLPTADYWRLGAIFGLIFLVLLVITGLL
WMPVVLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory