SitesBLAST
Comparing 17191 FitnessBrowser__Keio:17191 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2gn2A Crystal structure of tetrameric biodegradative threonine deaminase (tdcb) from salmonella typhimurium in complex with cmp at 2.5a resolution (hexagonal form) (see paper)
95% identity, 99% coverage: 3:328/329 of query aligns to 1:326/326 of 2gn2A
- active site: K56 (= K58), A81 (= A83), Q207 (= Q209), V211 (= V213), G213 (= G215), G235 (= G237), I308 (= I310), S309 (= S311)
- binding cytidine-5'-monophosphate: R51 (= R53), T52 (= T54), G53 (= G55), A114 (= A116), D117 (= D119), Y118 (= Y120), N312 (= N314)
8y1jA Structure of the pyridoxal 5'-phosphate-dependent (plp) threonine deaminase ilva1 from pseudomonas aeruginosa pao1 (see paper)
39% identity, 93% coverage: 18:324/329 of query aligns to 6:317/502 of 8y1jA
Sites not aligning to the query:
A4F2N8 L-threo-3-hydroxyaspartate ammonia-lyase; L-threo-3-hydroxyaspartate dehydratase; L-THA DH; EC 4.3.1.16 from Pseudomonas sp. (see paper)
40% identity, 95% coverage: 13:323/329 of query aligns to 8:316/319 of A4F2N8
- K53 (= K58) mutation to A: Loss of enzymatic activity.
2zr8A Crystal structure of modified serine racemase complexed with serine (see paper)
40% identity, 95% coverage: 12:323/329 of query aligns to 7:316/319 of 2zr8A
- active site: K53 (= K58), S78 (≠ A83), E204 (≠ Q209), G208 (≠ V213), D210 (≠ G215), G232 (= G237), I303 (= I310), S304 (= S311)
- binding magnesium ion: E204 (≠ Q209), G208 (≠ V213), D210 (≠ G215)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F57), K53 (= K58), S77 (= S82), S78 (≠ A83), N80 (= N85), H81 (= H86), P147 (= P152), G179 (= G184), G180 (= G185), G181 (= G186), G182 (= G187), G232 (= G237), E277 (= E282), T279 (≠ A284), S304 (= S311)
- binding serine: S78 (≠ A83), R129 (≠ I135), D231 (= D236), G232 (= G237), A233 (≠ C238), Q234 (≠ D239), T235 (≠ V240)
2zpuA Crystal structure of modified serine racemase from s.Pombe. (see paper)
40% identity, 95% coverage: 12:323/329 of query aligns to 7:316/319 of 2zpuA
- active site: K53 (= K58), S78 (≠ A83), E204 (≠ Q209), G208 (≠ V213), D210 (≠ G215), G232 (= G237), I303 (= I310), S304 (= S311)
- binding magnesium ion: E204 (≠ Q209), G208 (≠ V213), D210 (≠ G215)
- binding n-(5'-phosphopyridoxyl)-d-alanine: F52 (= F57), K53 (= K58), S77 (= S82), S78 (≠ A83), N80 (= N85), H81 (= H86), P147 (= P152), G179 (= G184), G180 (= G185), G181 (= G186), G182 (= G187), G232 (= G237), E277 (= E282), T279 (≠ A284), S304 (= S311)
O59791 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see 2 papers)
40% identity, 95% coverage: 12:323/329 of query aligns to 11:320/323 of O59791
- K57 (= K58) active site, Proton acceptor; modified: Lysino-D-alanine (Lys); alternate; modified: N6-(pyridoxal phosphate)lysine; alternate
- S82 (≠ A83) active site, Proton acceptor; mutation to A: Loss of racemase activity. Reduces D-serine dehydratase activity by 99%. Slightly reduced L-serine dehydratase activity.
- N84 (= N85) binding
- G183 (= G184) binding
- G184 (= G185) binding
- G185 (= G186) binding
- G186 (= G187) binding
- L187 (= L188) binding
- E208 (≠ Q209) binding
- G212 (≠ V213) binding
- D214 (≠ G215) binding
- S308 (= S311) binding
1wtcA Crystal structure of s.Pombe serine racemase complex with amppcp (see paper)
40% identity, 95% coverage: 12:323/329 of query aligns to 6:315/318 of 1wtcA
- active site: K52 (= K58), S77 (≠ A83), E203 (≠ Q209), G207 (≠ V213), D209 (≠ G215), G231 (= G237), I302 (= I310), S303 (= S311)
- binding phosphomethylphosphonic acid adenylate ester: N20 (≠ Y26), K47 (≠ R53), M48 (≠ T54), A109 (= A115), A110 (= A116), Y114 (= Y120)
- binding magnesium ion: E203 (≠ Q209), G207 (≠ V213), D209 (≠ G215)
- binding pyridoxal-5'-phosphate: F51 (= F57), K52 (= K58), N79 (= N85), G178 (= G184), G179 (= G185), G180 (= G186), G181 (= G187), G231 (= G237), E276 (= E282), T278 (≠ A284), S303 (= S311)
1v71A Crystal structure of s.Pombe serine racemase
40% identity, 95% coverage: 12:323/329 of query aligns to 6:315/318 of 1v71A
- active site: K52 (= K58), S77 (≠ A83), E203 (≠ Q209), G207 (≠ V213), D209 (≠ G215), G231 (= G237), I302 (= I310), S303 (= S311)
- binding magnesium ion: E203 (≠ Q209), G207 (≠ V213), D209 (≠ G215)
- binding pyridoxal-5'-phosphate: F51 (= F57), K52 (= K58), N79 (= N85), G178 (= G184), G179 (= G185), G180 (= G186), G181 (= G187), G231 (= G237), E276 (= E282), T278 (≠ A284), S303 (= S311), G304 (= G312)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
37% identity, 93% coverage: 11:317/329 of query aligns to 21:329/339 of Q7XSN8
- E219 (≠ Q209) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ G215) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
38% identity, 90% coverage: 28:324/329 of query aligns to 28:324/494 of 1tdjA
- active site: K58 (= K58), A83 (= A83), E209 (≠ Q209), S213 (≠ V213), C215 (≠ G215), G237 (= G237), L310 (≠ I310), S311 (= S311)
- binding pyridoxal-5'-phosphate: F57 (= F57), K58 (= K58), N85 (= N85), G184 (= G184), G185 (= G185), G186 (= G186), G187 (= G187), G237 (= G237), E282 (= E282), S311 (= S311), G312 (= G312)
P04968 L-threonine dehydratase biosynthetic IlvA; Threonine deaminase; EC 4.3.1.19 from Escherichia coli (strain K12) (see paper)
38% identity, 90% coverage: 28:324/329 of query aligns to 32:328/514 of P04968
- K62 (= K58) modified: N6-(pyridoxal phosphate)lysine
- N89 (= N85) binding
- GGGGL 188:192 (= GGGGL 184:188) binding
- S315 (= S311) binding
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
37% identity, 95% coverage: 5:318/329 of query aligns to 3:313/322 of 3l6bA
- active site: K54 (= K58), S77 (≠ A83), E203 (≠ Q209), A207 (≠ V213), D209 (≠ G215), G232 (= G237), T278 (≠ A284), L305 (vs. gap), S306 (= S311)
- binding malonate ion: K54 (= K58), S76 (= S82), S77 (≠ A83), N79 (= N85), H80 (= H86), R128 (≠ N132), G232 (= G237)
- binding manganese (ii) ion: E203 (≠ Q209), A207 (≠ V213), D209 (≠ G215)
- binding pyridoxal-5'-phosphate: F53 (= F57), K54 (= K58), N79 (= N85), G178 (= G184), G179 (= G185), G180 (= G186), G181 (= G187), M182 (≠ L188), V233 (≠ C238), E276 (= E282), T278 (≠ A284), S306 (= S311), G307 (= G312)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
37% identity, 95% coverage: 5:318/329 of query aligns to 2:317/323 of 7nbfAAA
- active site: K53 (= K58), S81 (≠ A83), E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215), G236 (= G237), L309 (vs. gap), S310 (= S311)
- binding calcium ion: E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215)
- binding magnesium ion: D3 (= D6), N244 (≠ L246)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (= G184), G183 (= G185), G184 (= G186), G185 (= G187), M186 (≠ L188), G236 (= G237), V237 (≠ C238), T282 (≠ A284), S310 (= S311), G311 (= G312)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (≠ Y26), L22 (≠ K27), T23 (= T28), P24 (≠ G29), L26 (≠ P31), T27 (≠ R32), F46 (≠ M51)
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
37% identity, 95% coverage: 5:318/329 of query aligns to 2:317/323 of 7nbdAAA
- active site: K53 (= K58), S81 (≠ A83), E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215), G236 (= G237), L309 (vs. gap), S310 (= S311)
- binding calcium ion: E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ I274), L278 (≠ V280), V314 (≠ I315), L316 (= L317)
- binding magnesium ion: D3 (= D6), N244 (≠ L246)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (= G184), G183 (= G185), G184 (= G186), G185 (= G187), M186 (≠ L188), G236 (= G237), V237 (≠ C238), E280 (= E282), T282 (≠ A284), S310 (= S311), G311 (= G312)
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
37% identity, 95% coverage: 5:318/329 of query aligns to 2:317/323 of 7nbcCCC
- active site: K53 (= K58), S81 (≠ A83), E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215), G236 (= G237), L309 (vs. gap), S310 (= S311)
- binding biphenyl-4-ylacetic acid: T78 (≠ A80), H79 (≠ C81), H84 (= H86), V148 (≠ I150), H149 (≠ P151), P150 (= P152)
- binding calcium ion: E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (= G184), G183 (= G185), G184 (= G186), G185 (= G187), M186 (≠ L188), G236 (= G237), V237 (≠ C238), T282 (≠ A284), S310 (= S311), G311 (= G312)
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
37% identity, 95% coverage: 5:318/329 of query aligns to 2:317/323 of 7nbcAAA
- active site: K53 (= K58), S81 (≠ A83), E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215), G236 (= G237), L309 (vs. gap), S310 (= S311)
- binding calcium ion: E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215)
- binding magnesium ion: D3 (= D6), N244 (≠ L246)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (= G184), G183 (= G185), G184 (= G186), G185 (= G187), M186 (≠ L188), G236 (= G237), V237 (≠ C238), T282 (≠ A284), S310 (= S311), G311 (= G312)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
37% identity, 95% coverage: 5:318/329 of query aligns to 2:317/322 of 7nbgAAA
- active site: K53 (= K58), S81 (≠ A83), E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215), G236 (= G237), L309 (vs. gap), S310 (= S311)
- binding calcium ion: E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215)
- binding pyridoxal-5'-phosphate: F52 (= F57), K53 (= K58), N83 (= N85), G182 (= G184), G183 (= G185), G184 (= G186), G185 (= G187), M186 (≠ L188), G236 (= G237), V237 (≠ C238), T282 (≠ A284), S310 (= S311), G311 (= G312)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ A83), G85 (≠ A87), Q86 (= Q88), I101 (≠ V103), K111 (= K113), I115 (≠ T117), Y118 (= Y120)
6zspAAA serine racemase bound to atp and malonate. (see paper)
37% identity, 95% coverage: 5:318/329 of query aligns to 2:310/320 of 6zspAAA
- active site: K53 (= K58), S74 (≠ A83), E200 (≠ Q209), A204 (≠ V213), D206 (≠ G215), G229 (= G237), L302 (vs. gap), S303 (= S311)
- binding adenosine-5'-triphosphate: S28 (= S33), S29 (≠ N34), I30 (≠ Y35), K48 (≠ R53), T49 (= T54), Q79 (= Q88), Y111 (= Y120), E266 (≠ Q275), R267 (= R276), K269 (= K278), N306 (= N314)
- binding magnesium ion: E200 (≠ Q209), A204 (≠ V213), D206 (≠ G215)
- binding malonate ion: K53 (= K58), S73 (= S82), S74 (≠ A83), N76 (= N85), H77 (= H86), R125 (≠ N132), G229 (= G237), S232 (= S241)
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
37% identity, 95% coverage: 5:318/329 of query aligns to 2:317/320 of 7nbhAAA
- active site: K53 (= K58), S81 (≠ A83), E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215), G236 (= G237), L309 (vs. gap), S310 (= S311)
- binding calcium ion: E207 (≠ Q209), A211 (≠ V213), D213 (≠ G215)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ A83), G85 (≠ A87), Q86 (= Q88), K111 (= K113), I115 (≠ T117), Y118 (= Y120), D235 (= D236), P281 (≠ G283), N313 (= N314), V314 (≠ I315), D315 (= D316)
Q9GZT4 Serine racemase; D-serine ammonia-lyase; D-serine dehydratase; L-serine ammonia-lyase; L-serine dehydratase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Homo sapiens (Human) (see 4 papers)
36% identity, 94% coverage: 9:318/329 of query aligns to 7:320/340 of Q9GZT4
- E13 (≠ I15) binding
- S31 (= S33) binding
- S32 (≠ N34) binding
- I33 (≠ Y35) binding
- K51 (≠ R53) binding
- T52 (= T54) binding
- K56 (= K58) modified: N6-(pyridoxal phosphate)lysine
- P69 (vs. gap) binding
- T81 (≠ A80) binding
- N86 (= N85) binding
- Q89 (= Q88) binding
- Y121 (= Y120) binding
- D178 (= D177) binding
- G185 (= G184) binding
- G186 (= G185) binding
- G187 (= G186) binding
- G188 (= G187) binding
- M189 (≠ L188) binding
- E210 (≠ Q209) binding ; binding ; binding
- A214 (≠ V213) binding ; binding ; binding
- D216 (≠ G215) binding ; binding ; binding
- N247 (≠ L246) binding ; binding
- K279 (= K278) binding
- S313 (= S311) binding
- N316 (= N314) binding
Query Sequence
>17191 FitnessBrowser__Keio:17191
MHITYDLPVAIDDIIEAKQRLAGRIYKTGMPRSNYFSERCKGEIFLKFENMQRTGSFKIR
GAFNKLSSLTDAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY
SAEVVLHGDNFNDTIAKVSEIVEMEGRIFIPPYDDPKVIAGQGTIGLEIMEDLYDVDNVI
VPIGGGGLIAGIAVAIKSINPTIRVIGVQSENVHGMAASFHSGEITTHRTTGTLADGCDV
SRPGNLTYEIVRELVDDIVLVSEDEIRNSMIALIQRNKVVTEGAGALACAALLSGKLDQY
IQNRKTVSIISGGNIDLSRVSQITGFVDA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory