Comparing 17213 b3140 N-acetylgalactosamine-specific enzyme IID component of PTS (NCBI) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
7dyrZ Cryoem structure of mannose transporter manyz and microcin e492 (mcea) complex (see paper)
35% identity, 99% coverage: 3:263/263 of query aligns to 2:272/274 of 7dyrZ
7xnoZ Cryo-em structure of the bacteriocin-receptor-immunity ternary complex from lactobacillus sakei (see paper)
33% identity, 96% coverage: 4:256/263 of query aligns to 4:294/301 of 7xnoZ
7vlxZ Cryo-em structures of listeria monocytogenes man-pts (see paper)
34% identity, 99% coverage: 4:263/263 of query aligns to 1:298/298 of 7vlxZ
8hfsZ The structure of lcna, lcia, and the man-pts of lactococcus lactis (see paper)
32% identity, 96% coverage: 5:256/263 of query aligns to 4:296/303 of 8hfsZ
>17213 b3140 N-acetylgalactosamine-specific enzyme IID component of PTS (NCBI)
MGSEISKKDITRLGFRSSLLQASFNYERMQAGGFTWAMLPILKKIYKDDKPGLSAAMKDN
LEFINTHPNLVGFLMGLLISMEEKGENRDTIKGLKVALFGPIAGIGDAIFWFTLLPIMAG
ICSSFASQGNLLGPILFFAVYLLIFFLRVGWTHVGYSVGVKAIDKVRENSQMIARSATIL
GITVIGGLIASYVHINVVTSFAIDNTHSVALQQDFFDKVFPNILPMAYTLLMYYFLRVKK
AHPVLLIGVTFVLSIVCSAFGIL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory