Comparing 17293 FitnessBrowser__Keio:17293 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P45425 N-acetylmannosamine kinase; ManNAc kinase; N-acetyl-D-mannosamine kinase; EC 2.7.1.60 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:291/291 of query aligns to 1:291/291 of P45425
2aa4A Crystal structure of escherichia coli putative n-acetylmannosamine kinase, new york structural genomics consortium
100% identity, 99% coverage: 1:289/291 of query aligns to 1:289/289 of 2aa4A
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
49% identity, 99% coverage: 1:287/291 of query aligns to 1:286/290 of 6jdbA
6jdoA Crystal structure of n-acetyl mannosmaine kinase with amp-pnp from pasteurella multocida
51% identity, 98% coverage: 1:285/291 of query aligns to 1:285/293 of 6jdoA
6jdhA Crystal structure of n-acetyl mannosmaine kinase from pasteurella multocida
51% identity, 98% coverage: 1:285/291 of query aligns to 1:285/293 of 6jdhA
6jdcA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac from haemophilus influenzae
48% identity, 99% coverage: 1:287/291 of query aligns to 1:266/269 of 6jdcA
3vglA Crystal structure of a rok family glucokinase from streptomyces griseus in complex with glucose and amppnp (see paper)
34% identity, 98% coverage: 3:287/291 of query aligns to 3:310/312 of 3vglA
3vgkB Crystal structure of a rok family glucokinase from streptomyces griseus (see paper)
34% identity, 98% coverage: 3:287/291 of query aligns to 3:310/312 of 3vgkB
2qm1B Crystal structure of glucokinase from enterococcus faecalis
29% identity, 97% coverage: 4:286/291 of query aligns to 9:319/325 of 2qm1B
3vovB Crystal structure of rok hexokinase from thermus thermophilus (see paper)
34% identity, 98% coverage: 1:286/291 of query aligns to 1:291/298 of 3vovB
7p7wBBB Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
31% identity, 83% coverage: 6:247/291 of query aligns to 9:264/306 of 7p7wBBB
7p9lAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
31% identity, 83% coverage: 6:247/291 of query aligns to 6:261/303 of 7p9lAAA
7p9pAAA Ubiquitin-like protein SMT3,N-acetyl-D-glucosamine kinase
31% identity, 83% coverage: 6:247/291 of query aligns to 7:262/304 of 7p9pAAA
Q93LQ8 Beta-glucoside kinase; EC 2.7.1.85 from Klebsiella pneumoniae (see paper)
28% identity, 97% coverage: 1:282/291 of query aligns to 1:281/297 of Q93LQ8
1z05A Crystal structure of the rok family transcriptional regulator, homolog of e.Coli mlc protein.
27% identity, 79% coverage: 59:287/291 of query aligns to 139:382/396 of 1z05A
Q8ZPZ9 N-acetyl-D-glucosamine kinase; GlcNAc kinase; EC 2.7.1.59 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
30% identity, 81% coverage: 6:241/291 of query aligns to 5:253/303 of Q8ZPZ9
2ap1A Crystal structure of the putative regulatory protein
30% identity, 81% coverage: 6:241/291 of query aligns to 7:255/305 of 2ap1A
4db3A 1.95 angstrom resolution crystal structure of n-acetyl-d-glucosamine kinase from vibrio vulnificus.
28% identity, 83% coverage: 6:247/291 of query aligns to 13:267/311 of 4db3A
5f7qE Rok repressor lmo0178 from listeria monocytogenes bound to operator (see paper)
25% identity, 97% coverage: 4:286/291 of query aligns to 85:385/396 of 5f7qE
Sites not aligning to the query:
5f7rA Rok repressor lmo0178 from listeria monocytogenes bound to inducer (see paper)
24% identity, 97% coverage: 3:285/291 of query aligns to 3:300/306 of 5f7rA
>17293 FitnessBrowser__Keio:17293
MTTLAIDIGGTKLAAALIGADGQIRDRRELPTPASQTPEALRDALSALVSPLQAHAQRVA
IASTGIIRDGSLLALNPHNLGGLLHFPLVKTLEQLTNLPTIAINDAQAAAWAEFQALDGD
ITDMVFITVSTGVGGGVVSGCKLLTGPGGLAGHIGHTLADPHGPVCGCGRTGCVEAIASG
RGIAAAAQGELAGADAKTIFTRAGQGDEQAQQLIHRSARTLARLIADIKATTDCQCVVVG
GSVGLAEGYLALVETYLAQEPAAFHVDLLAAHYRHDAGLLGAALLAQGEKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory