Comparing 17296 FitnessBrowser__Keio:17296 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lbcD D-sialic acid aldolase complexed with l-arabinose
100% identity, 100% coverage: 1:296/297 of query aligns to 1:296/296 of 3lbcD
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
100% identity, 100% coverage: 2:297/297 of query aligns to 7:302/302 of 2wpbA
4bwlA Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
100% identity, 100% coverage: 2:297/297 of query aligns to 4:299/299 of 4bwlA
4bwlC Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
100% identity, 99% coverage: 2:296/297 of query aligns to 2:296/296 of 4bwlC
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
99% identity, 98% coverage: 4:295/297 of query aligns to 1:292/292 of 1fdzA
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
99% identity, 98% coverage: 4:295/297 of query aligns to 1:292/292 of 1fdyA
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
88% identity, 100% coverage: 1:296/297 of query aligns to 2:297/297 of 8u8wA
Q9S4K9 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Clostridium perfringens (strain 13 / Type A) (see paper)
38% identity, 97% coverage: 5:291/297 of query aligns to 1:286/288 of Q9S4K9
Q2G160 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
37% identity, 97% coverage: 1:288/297 of query aligns to 1:287/293 of Q2G160
4wozB Crystal structures of cdnal from clostridium difficile in complex with mannosamine
36% identity, 99% coverage: 3:295/297 of query aligns to 1:288/290 of 4wozB
4woqC Crystal structures of cdnal from clostridium difficile in complex with ketobutyric
36% identity, 99% coverage: 3:295/297 of query aligns to 1:288/290 of 4woqC
4imgA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-glycolylneuraminic acid (see paper)
38% identity, 91% coverage: 4:273/297 of query aligns to 3:271/293 of 4imgA
4imfA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-acetylneuraminic acid (see paper)
38% identity, 91% coverage: 4:273/297 of query aligns to 2:270/292 of 4imfA
1f7bA Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid (see paper)
38% identity, 91% coverage: 4:273/297 of query aligns to 3:271/293 of 1f7bA
1f74A Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid (see paper)
38% identity, 91% coverage: 4:273/297 of query aligns to 3:271/293 of 1f74A
5kzdA N-acetylneuraminate lyase from methicillin-resistant staphylococcus aureus with bound sialic acid alditol (see paper)
35% identity, 96% coverage: 4:288/297 of query aligns to 3:278/284 of 5kzdA
1f73A Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii in complex with sialic acid alditol (see paper)
37% identity, 91% coverage: 4:273/297 of query aligns to 3:266/288 of 1f73A
1f7bC Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid (see paper)
36% identity, 91% coverage: 4:273/297 of query aligns to 3:263/285 of 1f7bC
6rb7A Ruminococcus gnavus sialic acid aldolase catalytic lysine mutant (see paper)
29% identity, 98% coverage: 6:296/297 of query aligns to 8:301/305 of 6rb7A
6rd1A Ruminococcus gnavus sialic acid aldolase catalytic lysine mutant in complex with sialic acid (see paper)
29% identity, 98% coverage: 6:296/297 of query aligns to 7:300/304 of 6rd1A
>17296 FitnessBrowser__Keio:17296
MATNLRGVMAALLTPFDQQQALDKASLRRLVQFNIQQGIDGLYVGGSTGEAFVQSLSERE
QVLEIVAEEAKGKIKLIAHVGCVSTAESQQLAASAKRYGFDAVSAVTPFYYPFSFEEHCD
HYRAIIDSADGLPMVVYNIPALSGVKLTLDQINTLVTLPGVGALKQTSGDLYQMEQIRRE
HPDLVLYNGYDEIFASGLLAGADGGIGSTYNIMGWRYQGIVKALKEGDIQTAQKLQTECN
KVIDLLIKTGVFRGLKTVLHYMDVVSVPLCRKPFGPVDEKYLPELKALAQQLMQERG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory