SitesBLAST
Comparing 17495 FitnessBrowser__Keio:17495 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1gl3A Aspartate beta-semialdehyde dehydrogenase in complex with NADP and substrate analogue s-methyl cysteine sulfoxide (see paper)
100% identity, 100% coverage: 1:367/367 of query aligns to 1:367/367 of 1gl3A
- active site: C135 (= C135), Q162 (= Q162), R267 (= R267), H274 (= H274)
- binding cysteine: C135 (= C135), Q162 (= Q162), I230 (= I230), E241 (= E241), R267 (= R267), H274 (= H274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R10 (= R10), G11 (= G11), M12 (= M12), V13 (= V13), T37 (= T37), S38 (= S38), C72 (= C72), Q73 (= Q73), A98 (= A98), C135 (= C135), S165 (= S165), G166 (= G166), G168 (= G168), A169 (= A169), Q350 (= Q350), A355 (= A355)
P0A9Q9 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Escherichia coli (strain K12) (see 2 papers)
100% identity, 100% coverage: 1:367/367 of query aligns to 1:367/367 of P0A9Q9
- RGMV 10:13 (= RGMV 10:13) binding
- TS 37:38 (= TS 37:38) binding
- Q73 (= Q73) binding
- C135 (= C135) active site, Acyl-thioester intermediate; mutation to A: Complete loss of activity.; mutation to S: 99.7% loss of activity.
- SGGGA 165:169 (= SGGGA 165:169) binding
- R173 (= R173) binding
- P193 (= P193) binding
- Q350 (= Q350) binding
P44801 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
72% identity, 100% coverage: 1:366/367 of query aligns to 1:369/371 of P44801
- RGMV 10:13 (= RGMV 10:13) binding
- TS 37:38 (= TS 37:38) binding
- Q74 (= Q73) binding
- R103 (= R102) binding ; mutation to K: 2-fold increase in affinity for ASA, 23-fold decrease in affinity for phosphate, and 275-fold decrease in activity.; mutation to L: 7-fold increase in affinity for ASA, 150-fold decrease in affinity for phosphate, and 1400-fold decrease in activity.
- C136 (= C135) active site, Acyl-thioester intermediate
- S166 (= S165) binding
- E243 (= E241) mutation to D: No change in affinity for ASA and 82-fold decrease in activity.
- K246 (= K244) binding ; mutation to R: 2-fold increase in affinity for ASA, nearly no change in affinity for phosphate, and 30-fold decrease in activity.
- R270 (= R267) mutation to K: 2-fold decrease in affinity for ASA and 825-fold decrease in activity.
- H277 (= H274) active site, Proton acceptor
- Q353 (= Q350) binding
1pquA Crystal structure of the h277n mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with NADP, s-methyl cysteine sulfoxide and cacodylate (see paper)
72% identity, 100% coverage: 1:366/367 of query aligns to 1:369/371 of 1pquA
- active site: C136 (= C135), Q163 (= Q162), R270 (= R267), N277 (≠ H274)
- binding cysteine: C136 (= C135), Q163 (= Q162), G167 (= G166), E243 (= E241), R270 (= R267)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), R10 (= R10), G11 (= G11), M12 (= M12), V13 (= V13), T36 (≠ S36), T37 (= T37), S38 (= S38), C73 (= C72), Q74 (= Q73), A99 (= A98), S166 (= S165), L354 (= L351), A358 (= A355)
1tb4A Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound periodate (see paper)
70% identity, 100% coverage: 1:366/367 of query aligns to 1:355/357 of 1tb4A
1ta4A Crystal structure of aspartate-semialdehyde dehydrogenase from haemophilus influenzae with a bound arsenate (see paper)
70% identity, 100% coverage: 1:366/367 of query aligns to 1:355/357 of 1ta4A
1nx6A Crystal structure of aspartate semialdehyde dehydrogenase from haemophilus influenzae as a tetrahedral hemithiocetal reaction intermediate with phosphate at 2.15 a (see paper)
70% identity, 100% coverage: 1:366/367 of query aligns to 1:355/357 of 1nx6A
5bntC X-ray crystal structure of a aspartate-semialdehyde dehydrogenase bound to NADP from pseudomonas aeruginosa
69% identity, 100% coverage: 1:366/367 of query aligns to 2:368/371 of 5bntC
- active site: C136 (= C135), Q163 (= Q162), R269 (= R267), H276 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), R11 (= R10), G12 (= G11), M13 (= M12), V14 (= V13), T38 (= T37), S39 (= S38), Q74 (= Q73)
1pqpA Crystal structure of the c136s mutant of aspartate semialdehyde dehydrogenase from haemophilus influenzae bound with aspartate semialdehyde and phosphate (see paper)
70% identity, 100% coverage: 1:366/367 of query aligns to 1:355/357 of 1pqpA
- active site: S122 (≠ C135), Q149 (= Q162), R256 (= R267), H263 (= H274)
- binding l-homoserine: S122 (≠ C135), Q149 (= Q162), G153 (= G166), R256 (= R267), H263 (= H274), Q339 (= Q350)
- binding phosphate ion: R89 (= R102), N121 (= N134), S122 (≠ C135), K232 (= K244)
7tcmA Crystal structure of aspartate-semialdehyde dehydrogenase from acinetobacter baumannii in complex with NADP
68% identity, 99% coverage: 4:366/367 of query aligns to 5:368/373 of 7tcmA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G9 (= G8), R11 (= R10), G12 (= G11), M13 (= M12), V14 (= V13), T38 (= T37), S39 (= S38), C74 (= C72), Q75 (= Q73), G76 (= G74), A100 (= A98), S167 (= S165), Q352 (= Q350), A357 (= A355)
3pzrA Crystals structure of aspartate beta-semialdehyde dehydrogenase from vibrio cholerae with NADP and product of s-carbamoyl-l-cysteine (see paper)
67% identity, 98% coverage: 4:364/367 of query aligns to 3:364/370 of 3pzrA
- active site: C134 (= C135), Q161 (= Q162), R267 (= R267), H274 (= H274)
- binding cysteine: C134 (= C135), Q161 (= Q162), G165 (= G166), E240 (= E241), R267 (= R267), H274 (= H274), Q350 (= Q350)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), R9 (= R10), G10 (= G11), M11 (= M12), V12 (= V13), S35 (= S36), T36 (= T37), S37 (= S38)
Q9KQG2 Aspartate-semialdehyde dehydrogenase 1; ASA dehydrogenase 1; ASADH 1; Aspartate-beta-semialdehyde dehydrogenase 1; EC 1.2.1.11 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) (see paper)
67% identity, 98% coverage: 4:364/367 of query aligns to 3:364/370 of Q9KQG2
4r5mA Crystal structure of vc-aspartate beta-semialdehyde-dehydrogenase with NADP and 4-nitro-2-phosphono-benzoic acid (see paper)
67% identity, 98% coverage: 4:364/367 of query aligns to 3:364/369 of 4r5mA
- active site: C134 (= C135), Q161 (= Q162), R267 (= R267), H274 (= H274)
- binding 4-nitro-2-phosphonobenzoic acid: C71 (= C72), G73 (= G74), G74 (= G75), A96 (= A97), A97 (= A98), S98 (= S99), R101 (= R102), K243 (= K244)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), R9 (= R10), G10 (= G11), M11 (= M12), V12 (= V13), T36 (= T37), S37 (= S38), Q72 (= Q73), G73 (= G74), G165 (= G166)
1mb4A Crystal structure of aspartate semialdehyde dehydrogenase from vibrio cholerae with NADP and s-methyl-l-cysteine sulfoxide (see paper)
67% identity, 98% coverage: 4:364/367 of query aligns to 3:364/369 of 1mb4A
- active site: C134 (= C135), Q161 (= Q162), R267 (= R267), H274 (= H274)
- binding cysteine: N133 (= N134), C134 (= C135), G165 (= G166), E240 (= E241), R267 (= R267), H274 (= H274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G8), R9 (= R10), G10 (= G11), M11 (= M12), V12 (= V13), T36 (= T37), S37 (= S38), C71 (= C72), Q72 (= Q73), G73 (= G74), A97 (= A98), S164 (= S165), Q350 (= Q350), L351 (= L351), A355 (= A355)
Q04797 Aspartate-semialdehyde dehydrogenase; ASA dehydrogenase; ASADH; Aspartate-beta-semialdehyde dehydrogenase; EC 1.2.1.11 from Bacillus subtilis (strain 168) (see paper)
27% identity, 96% coverage: 3:356/367 of query aligns to 6:330/346 of Q04797
- S98 (= S99) modified: Phosphoserine
- Y146 (≠ D151) modified: Phosphotyrosine
3pylC Crystal structure of aspartate beta-semialdehide dehydrogenase from streptococcus pneumoniae with d-2,3-diaminopropionate (see paper)
26% identity, 96% coverage: 4:356/367 of query aligns to 4:330/361 of 3pylC
4r5hA Crystal structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide-adenine-dinucleotide-phosphate and 3-carboxy-propenyl- phthalic acid (see paper)
26% identity, 96% coverage: 4:356/367 of query aligns to 4:330/359 of 4r5hA
- binding 3-[(1E)-3-carboxyprop-1-en-1-yl]benzene-1,2-dicarboxylic acid: S73 (≠ G75), T94 (≠ A98), S95 (= S99), R98 (= R102), N126 (= N134), C127 (= C135), Q154 (= Q162), G158 (= G166), K222 (= K244), R244 (= R267), H251 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (≠ R10), G11 (= G11), A12 (≠ M12), V13 (= V13), A35 (≠ S36), S36 (≠ T37), R38 (≠ Q39), S39 (≠ L40), T56 (≠ A57), S70 (≠ C72), A71 (≠ Q73), G72 (= G74), T75 (≠ Y77), N93 (≠ A97), T94 (≠ A98), P125 (≠ G133), N126 (= N134), C127 (= C135), G160 (= G168), M161 (= M179), G328 (= G354)
4r51A Crystal complex structure of sp-aspartate-semialdehyde-dehydrogenase with nicotinamide adenine dinucleotide phosphate and phthalic acid (see paper)
26% identity, 96% coverage: 4:356/367 of query aligns to 4:330/360 of 4r51A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (≠ R10), G11 (= G11), A12 (≠ M12), V13 (= V13), A35 (≠ S36), S36 (≠ T37), S39 (≠ L40), T56 (≠ A57), S70 (≠ C72), A71 (≠ Q73), G72 (= G74), N93 (≠ A97), T94 (≠ A98), N126 (= N134), C127 (= C135), G160 (= G168), M161 (= M179), G328 (= G354)
- binding phthalic acid: S73 (≠ G75), T94 (≠ A98), S95 (= S99), R98 (= R102), N126 (= N134), K222 (= K244)
4r4jA Crystal structure of complex sp_asadh with 3-carboxypropyl-phthalic acid and nicotinamide adenine dinucleotide phosphate (see paper)
26% identity, 96% coverage: 4:356/367 of query aligns to 4:330/359 of 4r4jA
- binding 3-(3-carboxypropyl)benzene-1,2-dicarboxylic acid: T94 (≠ A98), S95 (= S99), R98 (= R102), N126 (= N134), C127 (= C135), Q154 (= Q162), G158 (= G166), E219 (= E241), K222 (= K244), R244 (= R267), H251 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (≠ R10), G11 (= G11), A12 (≠ M12), V13 (= V13), A35 (≠ S36), S36 (≠ T37), R38 (≠ Q39), S39 (≠ L40), T56 (≠ A57), S70 (≠ C72), A71 (≠ Q73), G72 (= G74), T75 (≠ Y77), N93 (≠ A97), T94 (≠ A98), N126 (= N134), C127 (= C135), G160 (= G168), M161 (= M179), G328 (= G354)
3pyxB Crystals structure of aspartate beta-semialdehyde dehydrogenase complex with NADP and 2-aminoterephthalate (see paper)
26% identity, 96% coverage: 4:356/367 of query aligns to 4:330/359 of 3pyxB
- binding 2-aminobenzene-1,4-dicarboxylic acid: R98 (= R102), G158 (= G166), E219 (= E241), K222 (= K244), R244 (= R267)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G8), T10 (≠ R10), G11 (= G11), A12 (≠ M12), V13 (= V13), A35 (≠ S36), S36 (≠ T37), R38 (≠ Q39), S39 (≠ L40), T56 (≠ A57), S70 (≠ C72), A71 (≠ Q73), G72 (= G74), T75 (≠ Y77), C127 (= C135), S157 (= S165), G158 (= G166), G160 (= G168), M161 (= M179), N324 (≠ Q350), L325 (= L351)
Query Sequence
>17495 FitnessBrowser__Keio:17495
MKNVGFIGWRGMVGSVLMQRMVEERDFDAIRPVFFSTSQLGQAAPSFGGTTGTLQDAFDL
EALKALDIIVTCQGGDYTNEIYPKLRESGWQGYWIDAASSLRMKDDAIIILDPVNQDVIT
DGLNNGIRTFVGGNCTVSLMLMSLGGLFANDLVDWVSVATYQAASGGGARHMRELLTQMG
HLYGHVADELATPSSAILDIERKVTTLTRSGELPVDNFGVPLAGSLIPWIDKQLDNGQSR
EEWKGQAETNKILNTSSVIPVDGLCVRVGALRCHSQAFTIKLKKDVSIPTVEELLAAHNP
WAKVVPNDREITMRELTPAAVTGTLTTPVGRLRKLNMGPEFLSAFTVGDQLLWGAAEPLR
RMLRQLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory